KEGG   Alcanivorax dieselolei: B5T_00049Help
Entry
B5T_00049         CDS       T02259                                 

Definition
(GenBank) hypothetical protein
  KO
K09761  16S rRNA (uracil1498-N3)-methyltransferase [EC:2.1.1.193]
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:adi03009]
    B5T_00049
Enzymes [BR:adi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.193  16S rRNA (uracil1498-N3)-methyltransferase
     B5T_00049
Ribosome biogenesis [BR:adi03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    B5T_00049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrans_RNA
Motif
Other DBs
NCBI-ProteinID: AFT68338
UniProt: K0C737
Position
52893..53618
Genome map
AA seq 241 aa AA seqDB search
MPSMRRFFDDQEFHLDRSCQLGASPSQHIARVLRMSKGEEVVLFNGRGGEWRARLVAVDK
KTVEVLPLAHDPVERTPPLAVTLGLPMIKGERMDYAIQKATELGVARIQILDTARCEVRL
KGERQEKKREHWRQVAISACEQCGLNRPPEILTAMPLTNWLAGPLPGLKLIAHPGSEPFP
TERLSTQSELTLLTGPEGGFDDDELDKAFEAGFSAFALGSRVLRAETAPVALLAALWAWL
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaatgcgccgattcttcgatgaccaggagtttcacctcgaccggtcctgccag
ttgggcgccagccccagccagcatatcgcccgggtgttgcgcatgagcaagggagaggag
gtggtgctgttcaacggtcggggaggcgaatggcgggcccgcctcgtcgcggtggacaag
aaaaccgtggaggtgttgcccctggcccacgatccggtggaacgcacgccaccgctggcg
gtgaccctggggttgccgatgatcaaaggcgagcgcatggactacgccatccagaaagcc
accgagttgggcgttgcccgtatccagattctggataccgcccgttgcgaagtccgcctg
aaaggcgaacgtcaggagaaaaagcgtgagcattggcggcaggtggcgatcagcgcctgc
gagcagtgcggccttaaccggccgcccgagattctcaccgcgatgcccttgaccaactgg
ctggccggaccgctgcccgggcttaaactgattgctcatccgggtagtgagccgttcccc
accgaacgtctgagtacgcagagcgagctgaccctgctcaccggcccggaaggcgggttc
gacgacgacgaactcgataaagctttcgaagccggtttttccgcctttgcccttggcagc
cgggttttacgggcggaaaccgcgccggtggcgctgttggccgccttgtgggcctggtta
tcctga

DBGET integrated database retrieval system