KEGG   Alcanivorax dieselolei: B5T_00058Help
Entry
B5T_00058         CDS       T02259                                 

Definition
(GenBank) Peptidyl-prolyl cis-trans isomerase
  KO
K03775  FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC:5.2.1.8]
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:adi03110]
    B5T_00058
Enzymes [BR:adi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     B5T_00058
Chaperones and folding catalysts [BR:adi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    B5T_00058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C 3H
Motif
Other DBs
NCBI-ProteinID: AFT68347
UniProt: K0C9I1
Position
complement(61265..61750)
Genome map
AA seq 161 aa AA seqDB search
MPINKDKVVTLHYTLLDGVDGSELERSAEDAPLRYLHGAGNILPGLEAALEGKDVGEDVE
VTLEAKDAYGERDDSLRQRLPAKHFKHAGKLKPGKVVRLQTEQGPRLVTVVKVGLKTVDV
DANHPLAGRALRFQLSVKDIRDASAEEIAHRHVHGPGGHEH
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaataaagacaaggtcgttaccctgcactacaccctgctcgacggcgtcgat
ggcagcgaactggaacgcagcgccgaggatgcgccgctccggtatctgcacggtgccggg
aacattctgcccggccttgaggccgcgctggagggcaaggacgtcggcgaggatgtggaa
gtgacgctggaagccaaagatgcctacggcgaacgtgacgacagtctgcggcaacgcctg
ccggccaagcatttcaagcacgccggcaagctgaaacccggcaaagtggtccggctacaa
accgaacagggcccgcgcctggtcaccgtggtgaaggtgggtttgaaaaccgtggacgtg
gacgccaaccatccgctggcgggccgcgccttgcgcttccagctttcggtgaaggatatc
cgcgacgccagcgccgaggaaatcgcccaccgccacgtacatggcccgggtggccacgag
cactga

DBGET integrated database retrieval system