KEGG   Alcanivorax dieselolei: B5T_00067Help
Entry
B5T_00067         CDS       T02259                                 

Gene name
pilH
Definition
(GenBank) Type IV pili response regulator PilH
  KO
K02658  twitching motility two-component system response regulator PilH
Organism
adi  Alcanivorax dieselolei
Pathway
adi02020  Two-component system
Module
adi_M00507  ChpA-ChpB/PilGH (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:adi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B5T_00067 (pilH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:adi02044]
    B5T_00067 (pilH)
   02022 Two-component system [BR:adi02022]
    B5T_00067 (pilH)
   02035 Bacterial motility proteins [BR:adi02035]
    B5T_00067 (pilH)
Secretion system [BR:adi02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   B5T_00067 (pilH)
Two-component system [BR:adi02022]
 CheA family
  ChpA-ChpB/PilGH [MD:M00507]
   B5T_00067 (pilH)
Bacterial motility proteins [BR:adi02035]
 Pilus system
  Twitching motility proteins
   B5T_00067 (pilH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg FleQ B12-binding
Motif
Other DBs
NCBI-ProteinID: AFT68356
UniProt: K0CAB4
Position
complement(75321..75689)
Genome map
AA seq 122 aa AA seqDB search
MARILIVDDSPTETYKLREILEKHGHQVLEASNGADGVATTRSEQPDLVLMDVVMPGLNG
FQATRQLTKGADTRHIPIVIVTTKDQETDRVWGKRQGARDYLTKPVDEEVLLKTVERQLT
GA
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcacggattcttattgtcgatgactctcccacggagacgtacaagctgcgggagatt
ctggagaaacacggccaccaggtgctggaagccagcaatggggccgacggtgtggcgact
acccgttccgaacaaccggacctggtactgatggacgtggtgatgcccggcctcaatggt
tttcaagccacccggcagttaaccaaaggcgcggacacccgacacatcccgattgttatc
gtcaccaccaaggatcaggaaaccgaccgggtttggggcaaacgccagggcgcccgggat
tatctgaccaagccggtggatgaagaggttttactcaaaacggtcgagcgtcagctcacc
ggagcgtga

DBGET integrated database retrieval system