KEGG   Alcanivorax dieselolei: B5T_00075Help
Entry
B5T_00075         CDS       T02259                                 

Gene name
pyrR
Definition
(GenBank) Uracil phosphoribosyltransferase
  KO
K02825  pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00240  Pyrimidine metabolism
adi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B5T_00075 (pyrR)
Enzymes [BR:adi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     B5T_00075 (pyrR)
Transcription factors [BR:adi03000]
 Prokaryotic Type
  Other transcription factors
   Others
    B5T_00075 (pyrR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-ProteinID: AFT68364
UniProt: K0C4T8
Position
81596..82114
Genome map
AA seq 172 aa AA seqDB search
MHWNPEQIDSLLRDMASALESMDGADEAGTTALVGIESGGAWVARALNERLGKPLPLGVL
DANFYRDDFEKRGLKKSIKPSKLPFDVEGAHLILVDDVLMTGRTIRAAMNELFDFGRPAS
IRLMVLFDIGRRELPIRADICGEVLSLPADQRVELSGPEKLEASVQAVRNGH
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
ttgcattggaatccggaacagattgactccctgctgcgggacatggcgtccgcgctggag
agcatggacggagcggacgaggccggcaccaccgccctggtgggtatcgagtccggtggc
gcctgggtggcgcgggccttgaacgaacgcctgggcaagccgttgccattgggggttctg
gacgccaatttctaccgcgatgatttcgagaagcgcggcctgaagaaaagcatcaaaccg
tccaaattgccattcgacgtggaaggggcgcatctgatcctggtggacgatgtgctgatg
accggccgcaccattcgtgccgccatgaatgagttgtttgattttggccgcccggcctcg
atacggctgatggtgttattcgatatcggtcggcgcgagttacctattcgtgccgacatt
tgcggtgaggtgttgtccctgcccgccgatcaacgggtggaactgagcggaccggagaag
ctggaagcatcggtgcaggccgtccggaacggacactga

DBGET integrated database retrieval system