KEGG   Alcanivorax dieselolei: B5T_00248Help
Entry
B5T_00248         CDS       T02259                                 

Gene name
adhC
Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00010  Glycolysis / Gluconeogenesis
adi00071  Fatty acid degradation
adi00350  Tyrosine metabolism
adi00625  Chloroalkane and chloroalkene degradation
adi00626  Naphthalene degradation
adi00680  Methane metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01200  Carbon metabolism
adi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5T_00248 (adhC)
  09102 Energy metabolism
   00680 Methane metabolism
    B5T_00248 (adhC)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B5T_00248 (adhC)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    B5T_00248 (adhC)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B5T_00248 (adhC)
   00626 Naphthalene degradation
    B5T_00248 (adhC)
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B5T_00248 (adhC)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     B5T_00248 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 2-Hacid_dh_C PEP-CTERM Sacchrp_dh_NADP UDPG_MGDP_dh_N TrkA_N CLLAC
Motif
Other DBs
NCBI-ProteinID: AFT68535
UniProt: K0C7Q1
Position
complement(260588..261697)
Genome map
AA seq 369 aa AA seqDB search
MKSRAAVAWEAGKPLVIEEVDVAGPKAGEVLVKIAATGVCHTDAYTLSGTDPEGLFPSIL
GHEGAGVVQEVGEGVTSLKPGDHVIPLYTAECRKCKFCLSGKTNLCQAVRATQGQGLMPD
GTSRFSHKGKMLHHYMGTSTFSEYTVLPEISLAKVSKEAPLDKICLLGCGITTGIGAVLN
TAKVEPGSTIAVFGLGGIGLAVIQGAVMAKAERIIAIDINPEKETLARQFGATDFVNPKD
HSASIQEVIVELTDGGVDYSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGEEISTRP
FQLVTGRVWKGSAFGGVKGRTELPGYVERYMNGEIMIDEFVTHTMPLDEINTAFDLMHEG
KSIRSVILY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaagagccgccgtagcctgggaagcaggcaaacccctggtgatcgaggaagtg
gacgtggccggccccaaggccggtgaggtgctggtgaaaattgccgccaccggcgtctgc
cataccgatgcctataccctgtccggcaccgatcccgaaggtctgtttccctccatcctc
ggccacgaaggcgccggtgtggtgcaggaagtgggcgaaggtgtcaccagcctgaaaccc
ggtgaccatgtgattccgctgtacaccgccgaatgccgcaagtgcaagttctgcctctcc
ggcaagaccaacctgtgccaggcggtgcgcgccacccagggccagggtttgatgcccgac
ggcaccagccgtttctcccataaaggcaagatgctgcatcactacatgggcaccagcacc
ttctccgagtacaccgtgctgccggaaatctccctggccaaggtgagcaaggaagcgccg
ctggacaaaatctgcctgctcggctgtggcatcaccaccggtatcggcgcggtgctgaac
accgccaaggtagagccgggctccaccatcgcggtgttcggtctcggcggtatcggcctg
gccgtgatccagggcgcggtgatggccaaggcggaacgcatcatcgccatcgacatcaat
ccggaaaaggaaaccctggcccgccagttcggcgccaccgacttcgtcaatccgaaagac
cacagcgcctcgatccaggaagtgatcgtcgagctcaccgacggcggcgtggactactcc
ttcgaatgcatcggcaacgtcaacgtcatgcgctcggcgctggaatgctgccacaaaggc
tggggcgaatcggtgatcatcggtgtcgccggcgccggagaggaaatcagcacccgcccg
ttccaactggtcaccggccgtgtctggaagggttccgccttcggcggggtgaaaggccgt
accgaactgcccggctatgtggagcgctacatgaacggcgagatcatgattgatgagttc
gtcacccacaccatgccgctggacgagatcaacaccgcctttgatctgatgcacgaaggc
aaaagcattcgctcggtaattctttactaa

DBGET integrated database retrieval system