KEGG   Alcanivorax dieselolei: B5T_00308Help
Entry
B5T_00308         CDS       T02259                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B5T_00308
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     B5T_00308
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     B5T_00308
    1.1.1.-  
     B5T_00308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFT68595
UniProt: K0C7V6
Position
335725..336792
Genome map
AA seq 355 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPVVEPGTVGIEVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SKESAPVTMGHEFSGVVYAVGEGVSDIEVGQHVVVEPYIVADDVPTGPGDKYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISKDIPLDQAALIEPLSVGHHAFTRSGAKAGDVALVG
GAGPIGLLLSAILKAKGLSVIVTELSGARKQKAAESGVADHILDPSEVDVVEEVMKITDG
RGVDVAFECSSVNKVLDTLVAATISAGVVVIVSIWSHPATVNVHSVVMKELDVRGTIAYC
NDHQETIRLVEEGKINLEPFITQRIQLDDLVSKGFDTLIHNNESAVKIIVQPRIS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgtttttatgaccgtggtgatatccgcatcgaggacataccggagccc
gtggtggagcccggcacggtcggtatcgaggtggcatggtgtggcatttgcggtacggat
ttacatgagttcatggaagggccgatctttattcctccctgtggccatccgcatccgatc
tccaaggagtcagcccccgtcaccatgggccacgagttttctggtgtggtgtatgccgtg
ggggaaggggtgagcgacatcgaagtcggccagcatgtggtggtggagccttacatcgtg
gcggatgacgtgcccaccgggcccggcgataagtatcatctgtccaagaacatgaacttc
atcggcctgggtggtcggggcggcggcttgtccgagaaaatcgcggttaaacgtcgttgg
gtgcatccgatctccaaagacattccgctggaccaggctgccttgatcgagcctttgtcc
gtgggccatcacgccttcactcgcagcggtgccaaggctggcgatgtggcgttggttggt
ggggcgggccctattggcttactgctgtcagcgattttgaaagccaaggggctgagcgtt
atcgtcacggagctcagcggcgcacgtaagcaaaaagccgccgagtccggtgtcgccgac
catattctggacccctccgaagtggatgtggtcgaggaagtgatgaagatcaccgatggc
agaggcgtggatgtggcgtttgaatgttccagtgtgaacaaggttctggatactctggtg
gcggcgaccatctcagccggcgtagtggtgattgtgtccatctggagccatccggccacc
gtcaatgtacatagtgtggtaatgaaggagctcgacgtgcgcgggaccattgcgtactgc
aatgaccaccaggaaacgatcaggctggtggaggagggcaagatcaacctggagcccttc
atcactcagcgcattcaattggatgatttggtatcgaaagggttcgataccttgattcat
aacaatgagtcggccgtgaaaatcattgttcagcctcgaatcagctga

DBGET integrated database retrieval system