KEGG   Alcanivorax dieselolei: B5T_01517Help
Entry
B5T_01517         CDS       T02259                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00071  Fatty acid degradation
adi00280  Valine, leucine and isoleucine degradation
adi00281  Geraniol degradation
adi00310  Lysine degradation
adi00362  Benzoate degradation
adi00380  Tryptophan metabolism
adi00410  beta-Alanine metabolism
adi00640  Propanoate metabolism
adi00650  Butanoate metabolism
adi00903  Limonene and pinene degradation
adi00930  Caprolactam degradation
adi01040  Biosynthesis of unsaturated fatty acids
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01200  Carbon metabolism
adi01212  Fatty acid metabolism
Module
adi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B5T_01517 (fadB)
   00650 Butanoate metabolism
    B5T_01517 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    B5T_01517 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    B5T_01517 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5T_01517 (fadB)
   00310 Lysine degradation
    B5T_01517 (fadB)
   00380 Tryptophan metabolism
    B5T_01517 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5T_01517 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B5T_01517 (fadB)
   00281 Geraniol degradation
    B5T_01517 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B5T_01517 (fadB)
   00930 Caprolactam degradation
    B5T_01517 (fadB)
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B5T_01517 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B5T_01517 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     B5T_01517 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     B5T_01517 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFT69796
UniProt: K0CE20
Position
complement(1622047..1624194)
Genome map
AA seq 715 aa AA seqDB search
MIYQGNAVSVQLLDDGIAELKFDLQGESVNKFNRATLEDFQKAIDATKGSDQIKGLIVTS
GKKVFIVGADITEFTEMFSQEEAEIAKWSREANNIFSAFEDLDIPKVVAINGFAMGGGLE
MCLVCDFRVMSEQAQIGLPEVKLGIFPAFGGTVRMPRLVGVDNAVEWIATGAQQRPEKAL
KDGVVDAVVKHDDLHNAAIDLVKQCLAGKIDFRAKRQEKLEPLTLPPMENMMAFQTCTAM
VMQQAGKNYPAPVEAVKVMQKASGMKREEALDVEAQGFAKVAKTPQATALVGLFLADQQV
KKVNGKVAKTAKDIQQAAVLGAGIMGGGIAFQSALKGTPIIMKDIADKALDLGMNEASKL
LAKRVAKGKMDAAKMGKVLSSIRPTLNYGDFENVNVIVEAVVENTKVKQAVLAEVEEKVA
DGTILASNTSTISITKLAEALKKPENFGGMHFFNPVHMMPLVEVIRGEKTSDETIATLVA
YAQKMGKNPIVVNDCPGFLVNRVLFPYFAGFGMLVRDGADFQQVDKVMQKFGWPMGPAYL
LDVVGIDTGVHAAKVMADGFPDRMQHDFKDPTEVMFENERYGQKNGIGFYRYEQDKKGKP
KKVADEGSYELLKPIAAERKEFDAEEIIARMMIPMCTETVRCLEDNIVGSAAEADMAMIY
GIGFPPFRGGPLRYIDSIGTKAFADLCDKYAHLGALYEAPQMLKDKAAKGESFFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggcaacgccgtaagcgtacaactgcttgacgacggcatcgccgagctg
aagttcgaccttcagggcgagtccgtcaacaagttcaaccgggccaccctggaagacttc
cagaaagccatcgacgccaccaagggcagtgaccagatcaagggtctgatcgtcacctcc
ggcaagaaggtgttcatcgttggcgcggacatcaccgaattcaccgaaatgttctcccag
gaagaagcggagatcgccaaatggtcccgtgaagccaacaacatcttcagcgccttcgag
gatctggacattcccaaggtggtcgcgatcaacggcttcgccatgggcggcggcctggaa
atgtgcctggtgtgcgacttccgggtgatgagcgaacaggcgcagatcggcctgccggaa
gtgaaactgggcatcttcccggccttcggcggcactgtgcgcatgccgcgtctggtgggc
gtggacaacgccgttgagtggatcgccaccggcgcccagcagagaccggaaaaagccctg
aaggacggcgtggtggacgcggtggtcaagcacgacgacctgcacaacgccgccatcgat
ctggtcaagcagtgcctggccggcaaaatcgacttccgcgccaagcgccaggaaaaactg
gagccgctgacactgccgccgatggaaaacatgatggcgttccagacctgcaccgccatg
gtcatgcagcaggccggcaagaactacccggcgccggtggaagccgtgaaggtgatgcag
aaagcctccggcatgaagcgcgaggaagcactggacgtggaagcccaaggcttcgccaaa
gtggccaagaccccgcaagccaccgccctggtgggcctgttcctggccgaccagcaagtg
aagaaggtcaacggcaaggtcgccaagaccgccaaggacatccagcaggccgcggtactg
ggcgccggcatcatgggcggcggcatcgccttccagtccgccctcaaaggcaccccgatc
atcatgaaggacatcgccgacaaggcgctggacctgggcatgaacgaggcctccaagctg
ctcgccaagcgtgtcgccaaaggcaagatggacgccgccaaaatgggcaaggtgctctcc
tccattcgcccgaccctcaactacggcgactttgaaaacgtcaacgtgatcgtcgaagcc
gtggtggaaaacaccaaggtgaaacaagccgtgctggcggaagtggaagagaaagtggcg
gacggcactattttggcctccaatacctccaccatctccatcaccaaactggcggaagcg
ctgaaaaaaccggaaaacttcggcggcatgcacttcttcaacccggtacacatgatgccg
ctggtggaagtgatccgcggtgagaagacctccgacgaaaccatcgccactctggtcgcc
tacgcccagaaaatgggcaagaatccgatcgtcgtcaacgactgccccgggttcctggtg
aaccgcgtgctgttcccgtacttcgccggcttcggcatgctggtacgcgacggcgccgac
ttccagcaagtggataaagtgatgcagaaattcggctggcccatgggcccggcctacctg
ctcgacgtggtcggcatcgacaccggcgtgcacgccgccaaagtgatggcggacggcttc
ccggaccgcatgcagcacgacttcaaggaccccaccgaagtcatgttcgagaacgagcgc
tacggccagaagaacggcattggcttctaccgttacgagcaggacaagaagggcaaaccg
aagaaagtggccgacgaaggcagctacgagctgctcaagccgatcgccgccgagcgcaag
gaattcgacgccgaggagatcatcgcccgcatgatgatcccgatgtgcaccgaaaccgtc
cgctgcctggaagacaacatcgtcggctccgccgccgaagcggacatggcgatgatctac
ggcatcggcttcccgccgttccgtggcgggccgctgcgctacatcgacagcatcggcacc
aaggcattcgccgacctgtgcgacaagtacgcacacctgggcgccctttatgaagcgccg
caaatgctcaaggacaaggccgccaagggcgagtccttcttcgcgtaa

DBGET integrated database retrieval system