KEGG   Alcanivorax dieselolei: B5T_01645Help
Entry
B5T_01645         CDS       T02259                                 

Definition
(GenBank) Zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00010  Glycolysis / Gluconeogenesis
adi00071  Fatty acid degradation
adi00350  Tyrosine metabolism
adi00625  Chloroalkane and chloroalkene degradation
adi00626  Naphthalene degradation
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5T_01645
  Lipid metabolism
   00071 Fatty acid degradation
    B5T_01645
  Amino acid metabolism
   00350 Tyrosine metabolism
    B5T_01645
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B5T_01645
   00626 Naphthalene degradation
    B5T_01645
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B5T_01645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFT69924
UniProt: K0C8U9
Position
1757955..1758938
Genome map
AA seq 327 aa AA seqDB search
MRAMILRKNGEPLALIDCPAARPGPGQLRLQVEACGVCRTDLHVVDGELNGAKLPLIPGH
EIVGRVVELGPGASRFSMGQRVGIPWLGHSCGRCRYCEAGQENLCDTPGFTGYTLDGGYA
EHCVASQDYAFALPEEPDPVSLAPLLCAGLIGYRSYRMAGEAPRLGLYGFGAAAHILTQL
ACWQGREIYAFTRPGDAAAQAFARETGAIWAGGSDQAPPVELDAAILFAPVGALLPVALR
AVRKGGVVVCGGIHMSDIPGFPYADLWGERGVRSVANLTREDGEQFLRLASQAGIEVATR
SYRLDEANEALDDLRTGRLTGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccatgatcttgcgaaagaatggcgaaccactcgcattgatcgattgcccggcg
gctcgtcccggcccgggccagttgcgccttcaggtcgaggcctgcggtgtctgccgcacc
gatctgcatgtggtggacggcgagttgaacggcgccaaactccctctgatcccgggccac
gaaatcgtcgggcgggtggtggagctggggccgggtgccagccgcttttccatgggccag
cgcgttggtatcccctggctcggacacagctgtggacgatgccgctattgtgaagcgggc
caggagaatctttgtgacacgcccgggttcaccggttacacccttgatggaggctatgcc
gaacattgcgtggcttcacaggattatgcctttgccctgccggaagaacccgatcctgtc
agtctggcgccgttgttgtgcgccggtctgatcggctaccgctcctatcgaatggccgga
gaggcgccgcgattggggctctacggcttcggcgcggcggcgcacatcctgacccagctt
gcctgctggcaggggcgtgagatctacgcgtttacccgccctggagacgccgccgcgcag
gcgttcgcgcgggaaacgggggcaatctgggccggcggatcagaccaggcgccgccggtg
gaactggacgcggccattcttttcgctccggtgggcgctttgctgcccgtggctctgcgc
gcggtgcgcaaaggcggcgtggtggtctgtggcggtattcatatgagcgatatcccgggt
tttccctacgccgacttgtggggtgaacggggggtccgctccgtcgccaatctgactcgg
gaagacggcgagcagtttctgcgtctcgcctcgcaggcgggtatcgaggtcgcgacgcgg
agctatcggttggatgaggcaaacgaagcgctggacgatcttcgcaccggtcgtctcacc
ggcgcggcggtgttggtgccttga

DBGET integrated database retrieval system