KEGG   Alcanivorax dieselolei: B5T_02070Help
Entry
B5T_02070         CDS       T02259                                 

Definition
(GenBank) Alpha/beta hydrolase fold domain protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00903  Limonene and pinene degradation
adi00930  Caprolactam degradation
adi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B5T_02070
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    B5T_02070
Enzymes [BR:adi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     B5T_02070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Thioesterase
Motif
Other DBs
NCBI-ProteinID: AFT70344
UniProt: K0C9X4
Position
complement(2256248..2257159)
Genome map
AA seq 303 aa AA seqDB search
MRLRRIAAVARLPGGLPSGVTARKTTIGNEPAVPPGVPAVRVSPSQPTATVLYLHGGAFI
SGRFPTYAELCGQLAKRLNARVFWIDYRLAPEAAYPAALDDAHHAYKALAEDYPDEPLAL
IGDSAGGNLTLATLLRLRDAQAASPDSSPRMPACAVSISPGADAVGDTPSRQANAASDAM
LTPRMIEMATNLYLAGHDPRDPYVSPIYGDFRGLPPLLLTVSESEALRDDAYRVAHRARQ
AGVAVTLRARWNMPHVWPVFHSMLPEARQDVTEIVGFMRRHLSAPVACTRAVARTKLRLA
HSG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcggttacggcgcatcgccgcggtggcccgcctgccgggcgggctgccgtccggagtc
accgcgcgcaagaccaccattggcaatgaaccggccgtgccacccggcgtgccggcggtg
cgtgtcagccccagtcagcccacggccaccgtgctgtatctccacggtggcgcttttatc
agtggccgtttccctacttatgctgagctttgcgggcagctggccaagagactgaacgca
cgcgtgttctggatcgactaccgcctagcgccggaggcggcctacccggccgccctcgac
gatgcccaccatgcctacaaggcgctggccgaggactatcctgacgagccgctggccctg
atcggagattccgcgggtggcaacctcactctggccacgctgctgaggctgcgcgatgcg
caggccgcctcgcccgattcctccccccgcatgccagcctgcgccgtgtcgatctcgccc
ggcgccgatgcggttggcgatacaccgtcgcgccaggccaacgcggccagcgatgccatg
ctgactccacgcatgatcgagatggccaccaatctgtatctggccggccatgatccccgg
gatccctatgtctcaccgatatacggcgatttccgtggcctgccgcctcttttgctcact
gtgagcgaatccgaggccctgcgtgatgatgcctatcgggtagcgcaccgtgcgcgccag
gccggcgtggccgtgaccctgcgcgcccgctggaatatgccacatgtgtggccggtgttt
cattccatgttgccggaggcgcgccaggacgttaccgaaatagtcggctttatgcgccgg
catttgtcggcgcccgtagcatgcacccgggccgtggcacggacgaaactgcgcctcgcg
catagcggctaa

DBGET integrated database retrieval system