KEGG   Alcanivorax dieselolei: B5T_02190
Entry
B5T_02190         CDS       T02259                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:adi02044]
    B5T_02190
Secretion system [BR:adi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B5T_02190
SSDB
Motif
Pfam: T6SS_VasE DUF501
Other DBs
NCBI-ProteinID: AFT70464
UniProt: K0CA70
Position
complement(2401366..2402712)
AA seq 448 aa
MSHVSRMSKVLWGEGLFLRPQHFQRQDTYHEARLHHVAQSLHPYPWGIRQIRLDQRALES
GAVRILELSLVFPDGEIYQAPDADALPDPLRLEELPAGVSSTVIHLALPLLKEHGGNCND
DGGNARFTQTLMGTTDLYTDSAQAELTYLKKSVRLLTDDTPRDRYLTVPLLRVKRTSTGG
FELDDSFMPPCLHLDASDYLSRQLRGLLDALQAKSEALGNQQRQASQGLIEFRSSDVASF
WLLHTANTAYATLSHFFAQPKFHPERLYQELLRLAGNLLTYSTQHSLADLPQYRHDAPDE
AFAALFHLVRDLLDTVISTRHFAIPLAEIKPSYHRGMLDSQRIDAQTALYLGVAADMPGQ
ELVETVPVRFKVGAPDDVEKCVLAAMPGVKLIHASQIPAAIPVRPGSYYFSLEPRGPLYE
RMLKGQSVMVYVPTGVQDLKLELIAVTS
NT seq 1347 nt   +upstreamnt  +downstreamnt
gtgtcgcatgtcagccgcatgtcgaaggtactttggggggaaggtctgttcctccgccca
cagcattttcaacgtcaggacacttaccacgaagcgcgtcttcatcatgtcgcgcaaagc
ctgcacccctacccctggggcattcgccaaatccgcctggaccagcgcgcccttgaaagt
ggagccgttcgtattctggaactgtcactggtattcccggacggcgaaatttaccaggca
cccgatgccgacgctctgcccgatcctttacgtctggaagaactccccgccggagtgtcc
agcacggtgattcatctggctctgcctctgctcaaggagcatggcggcaactgcaatgac
gatggcggcaacgcccgcttcacgcagacgctaatggggaccaccgatctgtacaccgat
tccgcccaggcggagctgacctatctgaaaaagtccgtgcggctgcttaccgatgacacc
ccgcgcgaccgctatctgaccgtgcctttgttgcgggtcaagcgcacctccacgggcggg
ttcgagttggacgacagtttcatgccgccgtgcctccacctggacgcctcggattatctg
tctcgtcagttgcgtggactgctggatgccctgcaggccaaatccgaggcccttggcaat
cagcaacgccaagcctctcagggattgatcgaatttcgctcttcggacgtggcgtcattc
tggctgttgcataccgccaataccgcctacgccacgctgtcgcatttcttcgcccagccc
aaattccacccggaacggctctaccaggagttactgcgactggccgggaatctgctgacc
tactcgacacagcacagcctggcggatcttccccagtaccgtcacgacgccccggatgag
gccttcgcggcgctattccatctggtgcgggatctgctcgacacagttatttccactcgt
cacttcgccatcccgctggccgaaatcaaaccgtcttatcatcgcggcatgctggactct
cagcggattgacgctcagaccgcgctttatcttggcgtcgccgcggatatgcccggccag
gagctggtggaaacggtgccggtccggttcaaagtgggcgcgccggacgatgtggagaaa
tgcgttctggccgccatgcccggggtcaagttgatccatgccagtcagattcccgccgcc
atcccggtccgtcccggcagctactatttttccctggagccccgtggcccgctgtacgaa
cggatgctcaagggacaatcggtgatggtctatgtccccaccggcgtacaggacctgaaa
cttgaattgatcgcggtgacgtcatga

DBGET integrated database retrieval system