KEGG   Alcanivorax dieselolei: B5T_02561Help
Entry
B5T_02561         CDS       T02259                                 

Gene name
amiE
Definition
(GenBank) Hydrolase, carbon-nitrogen family
  KO
K01426  amidase [EC:3.5.1.4]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00330  Arginine and proline metabolism
adi00360  Phenylalanine metabolism
adi00380  Tryptophan metabolism
adi00627  Aminobenzoate degradation
adi00643  Styrene degradation
adi01100  Metabolic pathways
adi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    B5T_02561 (amiE)
   00360 Phenylalanine metabolism
    B5T_02561 (amiE)
   00380 Tryptophan metabolism
    B5T_02561 (amiE)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B5T_02561 (amiE)
   00643 Styrene degradation
    B5T_02561 (amiE)
Enzymes [BR:adi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     B5T_02561 (amiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AFT70833
UniProt: K0CE03
Position
2845204..2846244
Genome map
AA seq 346 aa AA seqDB search
MRHGDISSSNDTVGVAVVNYKMPRLHSKAEVLENAQKIADMIVGMKQGLPGMDLVIFPEY
SLQGIMYDPDEMMETAATVPGEETEIFSRACRKANTWGVFSVTGERHEEHPRKSPYNTLI
LIDNKGEIVQKYRKVIPWCPIEGWYPGGQTYVSDGPKGMKISLIICDDGNYPEIWRDCAM
KGAELIIRCQGYMYPAKEQQVLMSKAMAWANNCYVAVANAAGFDGVYSYFGHSALIGFDG
RTLGECGEEEMGIQFAQLSLSQIRDARANDQSQNHLFKILHRGYSGMHASGDGDKGLAEC
PFEFYKTWVNDAEKARENVEKITRSSAGVAQCPVGNVPYEGLEKEA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatggagatatctccagcagcaacgacaccgtcggcgtggcggtggtcaactac
aaaatgccacgtctgcacagcaaggccgaggttctggaaaacgcccagaaaatcgccgac
atgatcgtgggcatgaagcaaggtctgccaggcatggacctggtgatctttccggaatac
agcctgcaggggatcatgtacgaccccgacgaaatgatggagaccgccgccaccgtgccg
ggcgaggaaacggaaattttctcgcgcgcctgccgcaaagccaacacctggggggtcttc
tcggtcaccggcgaacgccacgaggaacatccgcgcaagtccccctacaacacgctgatc
ctgatcgacaacaaaggcgaaatcgtccagaagtaccgcaaggtcattccctggtgtccg
atcgagggctggtaccccggcggccagacctacgtcagcgacggccccaaaggcatgaag
atcagcctgatcatttgcgacgatggcaactatccggaaatctggcgcgattgcgccatg
aaaggcgctgaactgatcattcgctgccagggctacatgtacccggccaaggaacagcag
gtactgatgtccaaggccatggcctgggccaataactgctatgtggcggtggccaacgcc
gccggtttcgacggcgtctattcctacttcgggcattccgcgctcatcggtttcgatggc
cgcacgctgggcgaatgcggcgaggaagaaatgggcattcagttcgcccagctgtcgctg
tcgcaaatccgcgatgcccgcgccaacgatcaatcccagaatcatctgttcaagatcctg
caccggggctatagcggcatgcatgcctccggcgacggtgacaaggggctggcggaatgt
cccttcgagttctacaagacctgggtcaacgacgcggaaaaagcgcgcgaaaacgtggag
aagatcacccgctccagcgccggtgtcgcgcaatgcccggtgggtaacgtgccctatgag
ggcctggagaaagaggcctga

DBGET integrated database retrieval system