KEGG   Alcanivorax dieselolei: B5T_03038Help
Entry
B5T_03038         CDS       T02259                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00071  Fatty acid degradation
adi00072  Synthesis and degradation of ketone bodies
adi00280  Valine, leucine and isoleucine degradation
adi00310  Lysine degradation
adi00362  Benzoate degradation
adi00380  Tryptophan metabolism
adi00620  Pyruvate metabolism
adi00630  Glyoxylate and dicarboxylate metabolism
adi00640  Propanoate metabolism
adi00650  Butanoate metabolism
adi00900  Terpenoid backbone biosynthesis
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01200  Carbon metabolism
adi01212  Fatty acid metabolism
adi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B5T_03038 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    B5T_03038 (atoB)
   00640 Propanoate metabolism
    B5T_03038 (atoB)
   00650 Butanoate metabolism
    B5T_03038 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B5T_03038 (atoB)
   00072 Synthesis and degradation of ketone bodies
    B5T_03038 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5T_03038 (atoB)
   00310 Lysine degradation
    B5T_03038 (atoB)
   00380 Tryptophan metabolism
    B5T_03038 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B5T_03038 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B5T_03038 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B5T_03038 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adi04147]
    B5T_03038 (atoB)
Enzymes [BR:adi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B5T_03038 (atoB)
Exosome [BR:adi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5T_03038 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFT71306
UniProt: K0CIE8
Position
complement(3364065..3365243)
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAVGAFQGSLANLPATALGEAVVRKLLADTGVAADQISEVILGQVLTAG
AGQNPARQTAINAGLPQQVPALTINKVCGSGLKAVHLGSQAIRCGEADIIIAGGQENMSL
APYVLPKARTGLRMGHASLVDSMIQDGLWDAFNDYHMGITAENLAEKYGVTREEQDAFAA
ASQAKALAAIESGRFKDEITPVTIPQRKGDPKIFDTDEQPRAGTTAESLAGLRPAFKKDG
TVTAGNASTLNDGGAAVMLMSEARARELGLPILARLAGQASAGVDPAIMGIAPVSATRRC
LERAGWTLDQVDLIEANEAFAAQALSVGKELEWDAEKVNVNGGAIALGHPIGASGCRILV
TLLHEMQRRDVKRGLATLCIGGGQGVALAVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtggtcatcgtcgccgccactcgcaccgccgtcggtgctttccagggttcc
ctggccaatctgcccgccaccgccctgggtgaagcggtggtgcgcaaactgctggcggat
accggggtggcggcggatcaaatcagcgaagtgattctcggccaggtgctcaccgccggt
gccggccagaacccggcgcgtcagaccgcgatcaacgctggcctgccgcagcaggtgccg
gcgctcaccatcaacaaggtatgcggctccggcctcaaggcggtgcacctgggcagccag
gcaatccgctgcggggaagctgacatcatcatcgccggcggccaggaaaacatgagcttg
gcgccttatgtgctgcccaaggcccgcaccggtctgcgtatggggcacgcctcgctggtg
gattcgatgatccaggacggcctgtgggatgccttcaacgactaccacatgggcatcacc
gccgagaatctggcggagaaatacggcgttacccgggaggagcaggacgccttcgccgcc
gccagccaggccaaggcgctggccgccatcgaaagcggccgcttcaaggacgagatcacg
ccggtaacgattccccagcgcaagggcgacccgaagatattcgacaccgacgagcaaccg
cgcgccggcaccaccgccgagagcctggccggcctgcgtccggcgttcaagaaggatggc
acggtgaccgccggtaatgcctccacgctgaatgatggtggtgccgcggtgatgttgatg
agcgaagcccgcgccagggaactggggctgccgatcctcgcgcgtctggccgggcaggcc
agtgccggtgtggatccggcgatcatgggcatcgcgccggtgtccgccacccgccgctgc
ctggaacgggccggctggaccctggatcaggtggatctgatcgaagccaacgaagcgttc
gccgcccaggcgctgtccgtgggcaaggaactggagtgggacgcggagaaggtcaacgtg
aacggtggcgccatcgctctgggccacccgatcggtgcgtccggctgccgaatcctggtc
actctgctgcatgaaatgcagcgccgtgacgtcaaacgcggtctcgccacgctgtgtatc
ggtggcggtcagggcgtagctctggcggtggaacgctga

DBGET integrated database retrieval system