KEGG   Alcanivorax dieselolei: B5T_03848Help
Entry
B5T_03848         CDS       T02259                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase 2
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00010  Glycolysis / Gluconeogenesis
adi00620  Pyruvate metabolism
adi00640  Propanoate metabolism
adi00680  Methane metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5T_03848 (acsA)
   00620 Pyruvate metabolism
    B5T_03848 (acsA)
   00640 Propanoate metabolism
    B5T_03848 (acsA)
  Energy metabolism
   00680 Methane metabolism
    B5T_03848 (acsA)
Enzymes [BR:adi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     B5T_03848 (acsA)
Lipid biosynthesis proteins [BR:adi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   B5T_03848 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFT72110
UniProt: K0CI56
Position
4266551..4268488
Genome map
AA seq 645 aa AA seqDB search
MSEHKIHPVPESFKRQTLMDRDTYERWYAQSVDDPETFWAARAEELLHWHTRWDTVSDWD
FKEGRAAWFAGGKLNACYNCVDRHLPQRANQTAIIWEGDEPDQDKHISYQELFEQVSKLA
NVLRGRGVKKGDRVVIYMPMIPEAAYAMLACARIGAIHSVVFGGFSPEALKDRINDADAC
AVITADEGVRGGRTVPLKQNADKAMNGQSSVHSCVVVQRTGGNVDWNDSRDLWYHEAMAQ
ADPRCEPEWMDSEDPLFTLYTSGSTGKPKGVVHSTAGYLLQSALTHKYVFDYHDGDIYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDASRCWQVVDKHKVNIFYTAPTAIRA
LMGLGDEPVTKTSRQSLKLLGTVGEPINPEAWEWYYKVVGEERCPIVDTWWQTETGAIMI
APLPGAVDLKPGSATLPMFGVQPALMDPDGKELDGATSGNLVIKASWPSQIRTVYGDHQR
MIDTYFSAYPGYYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVLHKSIA
EAAVVGYQHDVKGQGIYAYVSLMAGATGSEELIEELRKLVTEEIGPIAKPDLIHFAPGLP
KTRSGKIMRRILRKIAADELDSLGDTSTLADPGVVDQLIETRRNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcataaaatccacccggttccggagtcattcaagcgtcagaccctcatggac
cgcgacacctatgagcgctggtacgcacaatccgtcgacgatccggaaaccttctgggcg
gcccgcgccgaagagctgctgcactggcatacccgctgggataccgtcagcgactgggat
ttcaaggaaggtcgcgcggcctggttcgccggtggcaaactgaacgcctgttacaactgc
gtcgatcgtcatctgccgcaacgcgccaaccagaccgccatcatctgggaaggcgacgag
ccggaccaggacaagcacatcagctaccaggaattgttcgagcaggtcagcaagctggcc
aatgtactgcgcggccgcggcgtcaaaaagggcgaccgggtggtgatttacatgcccatg
attccggaagccgcctacgccatgctcgcctgcgcccgtatcggcgccatccactcggtg
gttttcggcggcttctcaccggaagccctcaaggaccgtatcaacgatgctgacgcctgt
gccgtcatcaccgccgatgaaggcgtgcgcggcggccgcacggtaccgctgaaacagaac
gccgacaaagcgatgaatggccaatccagcgtccacagttgcgtggtggtacaacgcacc
ggtggcaacgtggattggaacgacagccgtgacctctggtatcacgaagccatggcgcag
gctgacccgcggtgcgaaccggaatggatggactccgaggatccgttgttcaccctctac
acctccggctccaccggcaagcccaaaggcgtggtacacagcaccgccggctatctgctg
caaagcgcgctgacccacaaatacgtattcgactatcacgacggtgacatctactggtgt
accgccgacgtgggctgggttaccggccacagctatatcgtttatggtccgctggccaat
ggcgccaccaccctgatgttcgagggcgtgcccacctacccggacgcctcccgttgttgg
caagtggtggacaagcacaaagtaaacatcttctacaccgcgcccaccgccattcgcgcg
ctgatgggactcggcgacgagcccgtcaccaagacgtcgcggcagagtctgaagttgctg
ggaacggtgggcgagccgatcaacccggaagcctgggagtggtactacaaagtggtgggc
gaggagcgctgcccgatcgtggacacctggtggcagaccgagaccggcgccatcatgatc
gccccgctacccggtgccgtggatctgaaaccgggctccgccaccctgcccatgttcggc
gtacagccggccctgatggacccggacggcaaggagctggacggcgccacttccggcaac
ctggtgatcaaagcgagctggccgagccagatccgtaccgtttacggcgatcatcagcgc
atgatcgacacctacttcagcgcctatccgggttactacttcaccggtgacggcgcccgc
cgcgacgaagacggctattactggatcaccggccgggtcgacgacgtattgaacgtgtcc
ggccaccgcctcggcaccgccgagatcgagtccgctctggtgctgcacaagagcatcgcc
gaggccgccgtggtgggttatcagcacgacgtcaaaggccagggcatctacgcctatgtg
tccttgatggccggcgccacgggcagcgaggagttgatcgaggaactgcgcaagctggtc
accgaggaaatcggcccgatcgccaagccggatctgatccacttcgcgcccgggctgccc
aagacccgttccggcaaaatcatgcgccgcatcctgcgcaagatcgccgccgatgagctc
gacagcctgggggacacctccactctggcggatcccggcgtggtcgaccagttgatcgaa
acccgccgcaaccgctaa

DBGET integrated database retrieval system