KEGG   Alcanivorax dieselolei: B5T_04039Help
Entry
B5T_04039         CDS       T02259                                 

Gene name
hemB
Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00860  Porphyrin and chlorophyll metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
Module
adi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B5T_04039 (hemB)
Enzymes [BR:adi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     B5T_04039 (hemB)
Exosome [BR:adi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5T_04039 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFT72300
UniProt: K0CIV8
Position
4473107..4474120
Genome map
AA seq 337 aa AA seqDB search
MSFPRAPWPHTRMRRMRKDDFSRRMMRESVLTPSDLIYPVFIIEGENRTETVASMPGVER
MSIDLLCREAEELAALGVPAMALFPSTPAEAKSLDAAEAWNPDGLVQRCTRAIKAAVPAM
AVITDVALDPFTIHGQDGILDEDGYVLNEETVQALVRQALSHAEAGADFVAPSDMMDGRI
GEIRQALEDNHHILTRIMAYSAKYASAYYGPFRDAVGSAGNLGKADKNTYQMDPGNSDEA
LHEIALDLAEGADVVMVKPGMPYLDVIRRVKDEFKVPVFAYQVSGEYAMHMAAFQNGWLD
EDKVMMESLLAFKRAGASGILTYFAKRAAQRLQNQPS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttccccgtgccccctggccgcatacccgcatgcgtcgcatgcgcaaagacgat
ttttcccgccgcatgatgcgcgagtccgtgctcacgcccagcgacctgatctacccggtg
ttcatcatcgaaggcgagaaccgtaccgaaacggtggcttccatgcccggcgtggaacgc
atgagcatcgatctgttgtgccgtgaggcggaggaactggccgccctgggcgtcccggcc
atggccctgttcccgtccactccggcggaggccaaaagcctggacgcggcggaagcctgg
aacccggacggtctggtgcagcgctgtacccgggcgatcaaggcggcggtgccggcaatg
gcggtgatcaccgacgtggccctggacccgttcaccattcacggccaggacggcatcctc
gacgaagacggctacgtgctcaacgaggaaacggtgcaggcgctggtgcgccaggctctg
tcccatgccgaggccggcgccgatttcgtcgcgccgtcggacatgatggacggccgtatc
ggcgagatccgccaggccctggaagacaaccaccacatcctcactcgcatcatggcttac
tccgccaagtacgcttccgcctactacggcccattccgcgacgcggtgggctccgccggc
aatctgggcaaggcggacaagaacacttatcagatggacccgggcaactccgacgaggcg
ttgcacgaaatcgccctggatctggccgagggcgccgacgtggtgatggtgaagccgggc
atgccctatctggatgtgatccggcgagtcaaggacgagttcaaagtgccggtgttcgcc
taccaagtcagcggcgaatacgccatgcacatggccgcgttccagaacggctggctggat
gaagacaaggtcatgatggagtccctgctggcgttcaagcgggccggcgccagcggcatc
ctcacctatttcgccaaacgcgcggcgcaacggctgcagaaccagccctcctga

DBGET integrated database retrieval system