KEGG   Alcanivorax dieselolei: B5T_04393Help
Entry
B5T_04393         CDS       T02259                                 

Definition
(GenBank) Alkane hydroxylase
  KO
K00496  alkane 1-monooxygenase [EC:1.14.15.3]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00071  Fatty acid degradation
adi00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B5T_04393
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    B5T_04393
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.3  alkane 1-monooxygenase
     B5T_04393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AFT72652
UniProt: K0CLJ4
Position
complement(4862782..4863966)
Genome map
AA seq 394 aa AA seqDB search
MKTVTMQTQSGEVQEWRDSRRYLWLLSTLTMLLPLFTVWLASSTGWAVFWWFGFLFVFGV
IPLLDMLLGEETENPPEALVPRLEQDRYYRWAVYVCLPFLYGAFIYAAWVAATWSLPWYS
YLGLAVSTGCATGIAINTAHEMGHKTDRHEKWMAKLCLAPVFYGHFYVEHNRGHHVRVST
PEDPASSRFGETFWEFLPRTVIGSLKSAWSLEKQRLERQGLSVWSWQNDNLQAWALSAVL
WGVLMLWLGWAVVPFLLIQSLFGFQLLEVVNYLEHYGLLRQKKDNGRYERCLPEHSWNSN
RRVTNIFLYQLQRHSDHHAYPTRSYQSLRHFDESPQLPGGYASMILLAWVPPLWFRIIDP
MVVRHYQGDMSRANIKPRIRDEVLARYGGREPVN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgtaaccatgcagactcaatcaggcgaagtacaagaatggcgggacagtcgc
cgctacctttggttgctcagcactctgaccatgctgttgcccctgttcacggtctggctg
gccagcagtaccggctgggccgtgttctggtggtttggattcctgttcgtattcggggtg
atcccgctgctggacatgctgcttggcgaagagaccgagaatccgccggaagcgctggtg
ccgcggttggaacaggaccggtattaccgctgggcggtgtatgtgtgcctgccgtttctt
tatggcgcctttatttatgccgcctgggtggccgccacctggagtctgccctggtacagc
tatctggggctggcggtctccacgggctgcgccacgggtatcgccatcaataccgcccat
gagatggggcacaagaccgaccgccacgagaaatggatggccaagctatgtctcgccccg
gtgttctacgggcacttctatgtggaacacaatcgtgggcatcacgtcagggtgtccacc
ccggaggatccggcatcttcccggttcggcgagacgttctgggagttcctgccgcgcacc
gtgatcggcagccttaaatccgcctggtcgctggagaaacagcgactggagcggcaggga
ctttcggtgtggagctggcagaacgacaatctgcaggcctgggcactgtcggcggtgctt
tggggtgtcctgatgctgtggttgggctgggcggtggtgccgttcctgctgattcagagc
ctgttcggttttcagttgctggaggtggtcaattatctcgagcactacggcttgttacgg
caaaaaaaggacaatgggcgttatgaacgctgtctgccggagcattcctggaattcgaac
cgccgggtaaccaatattttcctctaccagttgcaacggcattccgatcatcacgcctac
cccacgcgcagctatcaatcgctgcggcatttcgatgaatccccccaattaccgggcgga
tacgcatcgatgatcctgctggcgtgggtacctccgctgtggttcaggatcatcgacccg
atggtggtgcgccattatcaaggcgatatgagccgcgccaacatcaaaccgcggatccgg
gacgaggtattggctcggtatggtggccgggagccggtgaactga

DBGET integrated database retrieval system