KEGG   Alcanivorax dieselolei: B5T_04396Help
Entry
B5T_04396         CDS       T02259                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFT72655
UniProt: K0CJS7
Position
4865868..4867478
Genome map
AA seq 536 aa AA seqDB search
MTAVSNAMPQYAPQVDDEEFRCLPRRLQELAAEQGDHPAIYDDNGNLTWRQFVDQVNRVA
NRLIDAGLQPGDTVAGLSENSIPYFTLFMGVLTAGGCMVPLSSMAAGDTLALMINDCDAR
FLFISRKNQELITPLLDQLENVAPQQRIALDFQDNGWSNFMDWVGDAPSTRPDREPGADD
PFNIIYSSGTTGVPKGILHDHRLRSRQMDRFTALGFDNTAINLVSTPLYSNTTLVSVLPT
LFGGGTIVTMGKFDARKFLELCEKHRVTHAMLVPVQYQRILSDPEFDRFDLSSFKVKFST
SAPLRGHVIAEVMQRWPGNIIEFYGLTEGGVSTILNCAEFPDKWDTVGRAGEGCELRIID
EDLKEVPPGTIGEIVGRAGAMMRGYYKREDKTNEMLWTSPKGEVFYRTGDMGRLDEDGFL
SVLDRRKDMIISGGFNIYAEDLEKMLLKHPDVADAAVIAIPSEQWGETPLGLVVRRQGSA
TGTDEIRDWANQQLGKAQRLHDVELRDHLPRSTIGKILKRELRDPYWKEQQQQERG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtcagtaacgccatgccccagtacgcaccgcaagtcgacgatgaagagttc
cgctgtctgcctcgccggctccaggagttggccgcggaacagggcgatcatccagcgatt
tacgatgacaacggcaacctgacctggcggcagttcgtggatcaggtcaaccgcgtggcc
aatcgcctgattgacgccggcctgcaacccggcgataccgtggccggcctgtccgaaaac
agcattccctattttaccctgttcatgggcgtgctgaccgccggcggctgcatggttccg
ctgtccagcatggccgccggggacaccctggcgctgatgatcaacgactgcgatgcccgc
ttcctgttcatttccagaaaaaatcaggaattgatcacgccactgctggatcagttggaa
aacgtcgccccacagcagcgcatcgccctggacttccaggataatggctggagcaacttc
atggactgggttggcgacgcccccagcacccgcccggatcgcgaacccggcgcggacgac
ccattcaatattatctacagctccggcaccaccggcgtgcccaagggcattttgcacgac
catcgcctgcggtcccggcaaatggaccgtttcaccgcgctgggattcgataataccgcg
atcaacctggtgtccacaccgctgtactccaacaccactctggtttccgtgctgcccact
ctgttcggtggcggcaccatcgtcaccatgggcaaattcgacgcacgcaaattcctcgaa
ttgtgcgagaagcatcgcgtcacccacgccatgttggtaccggtccagtatcagcggatc
ctttccgatccggaattcgatcgtttcgacctgagcagcttcaaagtgaagttctccacc
agtgcgcccctgcgtggccatgtcattgccgaggtgatgcaacgctggccaggcaatatc
atcgagttctacggcctcaccgagggtggcgtcagcaccatcctcaactgtgctgaattc
cccgataaatgggataccgtcggccgtgccggtgagggctgtgagctgcgcatcatcgac
gaggatctcaaggaagtgccccccggcaccattggcgagatcgtcggtcgcgccggcgcc
atgatgcgcggttactacaaaagggaagacaaaaccaacgagatgctctggaccagcccg
aaaggggaagtgttctatcgcaccggtgatatgggccggctcgacgaggacggcttcctg
tccgtgctggatcgccgcaaggacatgatcatttccggtggcttcaacatctatgccgaa
gacctggaaaagatgctgctcaagcaccccgatgtggcggatgcggcggtgatcgccatc
cccagcgaacaatggggtgaaacaccgttgggcctggtggtgcgccgccagggcagcgcc
accggcaccgacgagatccgcgactgggccaaccagcaactgggcaaggctcagcgtctg
cacgacgtggaacttcgggatcatttgccacgcagcaccattggcaagattctgaagcgg
gaactgcgtgacccttactggaaagagcagcaacagcaagaacggggctga

DBGET integrated database retrieval system