KEGG   Alcanivorax dieselolei: B5T_04397Help
Entry
B5T_04397         CDS       T02259                                 

Definition
(GenBank) Phospholipase D active site motif domain protein
  KO
K06132  cardiolipin synthase C [EC:2.7.8.-]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00564  Glycerophospholipid metabolism
adi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B5T_04397
Enzymes [BR:adi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     B5T_04397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLDc_2 PLDc
Motif
Other DBs
NCBI-ProteinID: AFT72656
UniProt: K0CLX4
Position
complement(4867485..4868888)
Genome map
AA seq 467 aa AA seqDB search
MSDTTRSRSRSSLVPGAGVDSDFALVAEAGEAFLLRMATARAARRSLDLQYYIWDNDQVG
RRLIWCVLEAARRGVRVRLLLDHINQLGRDRIWATLNAHPNVEVRLFNPLRGRGLNLLRW
LYRAPKLNRRMHNKAWIVDGEAAIVGGRNISEHYFGVNAVTNFRDLDIYADGPIAADTQD
AFDRYWHSALSVNLRQFLRRSSDDAEALWTKLDKEQRSRHRDDTALSERALQAVWARRVR
APAALLFDSPEKAHGSSQRMMGTQLARLLGRHSAREILIEASYFIPGDDFTRALSGWRKR
GCRVAVLTNSLATNDVIAAHAAYQRYRPALVDAGLELHELQPNARSMMRQARLLRGRSKA
SLHTKAMVLDRRELFVGSFNADPRSVHFNTEMGYYIYSPALAASVAAFIEEGMAPQNSYR
LSREEGRLTWAGGSDQGPVVCHREPLVSIPRRLASAVLALLPIENLL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgataccaccagatccagatcgcggtcgtccctggtgccgggagccggcgtcgat
tccgacttcgcgttggttgccgaagccggcgaagcgttcttgctgcgtatggcgacagcc
cgggccgccaggcgttctctggatctgcagtattacatctgggacaacgatcaggtcgga
cgtcggttgatatggtgcgtactcgaggcggcacgccgtggtgtgcgggtgcgtttgctg
ctggatcatatcaatcagttgggtcgggaccggatttgggcgaccttgaacgctcatccc
aatgtggaagttcgtctgttcaatccgttacgaggtcgcggccttaatctgctgcgctgg
ctttatcgggcacctaagctcaaccgccgcatgcataacaaagcctggatcgttgatggt
gaggccgccattgtcggagggcggaacatctccgaacactactttggtgtcaatgcggtc
accaacttccgggacctggatatttacgccgatggcccgatcgccgccgacacgcaggac
gcctttgatcgatattggcatagcgctttgtcggtgaacctgaggcagttcctgcgccgt
tccagcgatgacgcggaagcattgtggacgaagctggataaggaacaacgctcccggcat
cgggacgataccgcgttatccgaacgcgccctgcaggccgtatgggcaagacgggtccgc
gccccggcggcgttgctattcgacagtccggaaaaagcgcacggctcttctcagcgaatg
atgggaacacaactggcccggttgcttggccgccattccgcccgggagattctgatcgaa
gccagctacttcattcccggtgatgacttcacccgcgcgttaagcggttggcgcaaacgg
gggtgccgggtggcggtgctgaccaacagtctggccaccaacgatgtcattgccgcccat
gccgcctatcaacgctatcgcccggcgctggtggatgccgggttggaattgcacgaactg
caacccaatgcccgcagcatgatgcgtcaggcccggctgttgcgcgggcgatccaaagcc
agtttgcataccaaggccatggtgctggatcggcgtgaattgtttgtcggctcgtttaac
gccgatccccgttccgtgcacttcaacaccgagatggggtactacatctactctccggcg
ttggcagcgtcggtggccgcgttcatcgaggaaggcatggcgccacagaacagctatcgg
ctgtctcgtgaggaaggacggctgacatgggccgggggaagtgaccagggcccggtggtc
tgtcaccgggaaccactggtatcgataccgcgccggttggccagcgcggtgttggcgttg
ctgccgatcgagaatctgctgtaa

DBGET integrated database retrieval system