KEGG   Alcanivorax dieselolei: B5T_04398Help
Entry
B5T_04398         CDS       T02259                                 

Definition
(GenBank) Large-conductance mechanosensitive channel
  KO
K03282  large conductance mechanosensitive channel
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adi02000]
    B5T_04398
Transporters [BR:adi02000]
 Other Transporters
  Pores ion channels [TC:1]
   B5T_04398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MscL YoaP OAD_gamma AlphaC_N GRIM-19
Motif
Other DBs
NCBI-ProteinID: AFT72657
UniProt: K0CLK1
Position
complement(4868917..4869348)
Genome map
AA seq 143 aa AA seqDB search
MGMIKEFREFAIKGNMVDMAVGIIIGGAFATIVKSLVADVIMPPIGLLLGGVDFANLFVV
LRGAGEFTTLAEAQAAGAVTINYGVFFNNVISFLIVAWAVFFLVRAINRLKREEEKAEEA
AAPPPIPEDILLLREIRDNLKQR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgatcaaggaatttcgtgaattcgcgataaagggaaacatggtcgatatggcg
gtgggtatcatcatcggtggggcgttcgccaccatcgtgaagagcctggtcgccgacgtc
atcatgccacccatcgggttgctgctgggcggggtggacttcgccaatttgttcgtggtt
ctgcgcggtgccggtgagttcaccaccttggccgaggctcaagccgccggcgccgtgacg
atcaactatggggtgttcttcaataatgtcatcagttttctgatcgttgcctgggcggtg
ttcttcctggtgcgcgccattaacaggctcaagcgtgaggaggaaaaagcagaggaggcc
gccgcgccgccgccgatcccggaggatatcttgttgctgcgggaaatccgtgacaacctt
aaacaacgttga

DBGET integrated database retrieval system