KEGG   Alcanivorax dieselolei: B5T_04412Help
Entry
B5T_04412         CDS       T02259                                 

Definition
(GenBank) Isochorismatase hydrolase
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: AFT72671
UniProt: K0CLZ4
Position
4883536..4884012
Genome map
AA seq 158 aa AA seqDB search
MRQALLIVDVQPSFSPPAWLSRTIGLLLGHMPTVATVECHDEAITPFQAQLGWRPPEHER
SLIAADRQFVKYGYRPTDEVLDHLRQLSPERVLVCGIQTETCVLAAGFALFDLGLRPTLV
TDLTVGSSLDPSGALGIRLWRHHFGHTTTLAEVLATST
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggctctgttgatcgtcgatgtgcaaccctccttttcaccgccggcctggcta
tcccggaccattggcctattacttggccacatgccgacggtagcgaccgtggagtgtcat
gacgaagccattacgccctttcaggcgcaattgggttggcgaccgccggaacatgagcgg
agtctgatcgcggccgaccgacagtttgttaagtacggctaccgtcccaccgacgaggta
ctggatcatctccgccaactgtctccggaaagggttctggtgtgcggcatccagaccgag
acctgcgtactcgccgccggcttcgcgctgtttgatctgggactgcgcccgaccctggtc
acggatttgaccgtgggctcatcactggatccctccggcgcgctcggcattcggctttgg
cggcatcacttcgggcacaccaccacattggcggaggtactcgcgacaagcacctga

DBGET integrated database retrieval system