KEGG   Alcanivorax dieselolei: B5T_04414Help
Entry
B5T_04414         CDS       T02259                                 

Definition
(GenBank) Vanillate demethylase oxygenase subunit
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske
Motif
Other DBs
NCBI-ProteinID: AFT72673
UniProt: K0CJ67
Position
complement(4885010..4886050)
Genome map
AA seq 346 aa AA seqDB search
MNCREQLNQQDFTLEPALLNDWHVVAASDEVTEGKLIPSTLFERDLVIWRDSGGQAHVWE
DLCIHRGARLSKGFIASDRVVCPYHGWNYDGTAQCRLIPASPGETPMKKAKAISHHVQEA
YGFIWTSLGEPEHDIPDFPEWNDDSYKKVVCGPYRFKSGYRAVENFIDPTHFPFVHAGVN
GLMDDPDPIGAYDVWEENGALASSEVQVTQPYGDPRNVPVTAFYAYKCLRPLVAYFKKRV
LITDPDRAHEGNPNDRFCTYLTAQQVSETESIVRICCAMNFNPMPTDDEVRQRQDLVYAQ
DSDIVDTQRPERIPTDLRQELHHRTDLLGMKYRSWLQKMGVQYGTV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcagagaacagctcaaccagcaggactttaccctggagcccgcgttgttgaat
gattggcacgtggtggccgcttccgacgaagtaacggaaggcaaactgataccctccacc
ctgttcgagcgggatctggtgatctggcgtgattccggtggtcaggcccatgtctgggaa
gatctgtgcatccaccggggggcgcgactttccaaagggtttatcgccagtgaccgggtc
gtgtgtccctatcatggctggaactacgatggcacggcacagtgccggttgatccctgct
tccccgggggaaacaccgatgaaaaaggccaaggccatcagtcatcacgtccaggaagcc
tacggcttcatttggaccagcctgggggagccggagcacgatattccggatttccccgag
tggaatgatgacagctacaagaaggtggtgtgtggaccctatcgcttcaaatccggctac
agggcggtggaaaactttattgaccccacccattttcccttcgtgcacgcgggcgtgaat
ggtctgatggatgatccggatccgatcggggcttacgacgtctgggaggaaaacggtgct
ctggcctcttccgaagtgcaagtgacccagccttatggggatccgcgtaatgtgccggta
accgctttctacgcctacaaatgtttgcgtccattggtggcttattttaaaaagcgcgtc
ctgatcacggatccggaccgtgcccatgaagggaaccccaatgatcgcttctgcacttat
ctgaccgctcaacaggtgagcgagacagaaagcatcgtccggatttgctgcgccatgaac
ttcaaccccatgccgacggatgatgaagtgcgtcaacgccaggatctggtttacgcgcag
gacagcgacattgtcgacacgcagcgtccggagcgcatccccaccgatctgcgtcaggaa
ctccaccaccgtaccgacctgctcggcatgaagtatcgttcctggctgcagaagatggga
gtccagtatggcacggtctga

DBGET integrated database retrieval system