KEGG   Alcanivorax dieselolei: B5T_04417Help
Entry
B5T_04417         CDS       T02259                                 

Gene name
atpD
Definition
(GenBank) ATP synthase F1, beta subunit
  KO
K02112  F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00190  Oxidative phosphorylation
adi01100  Metabolic pathways
Module
adi_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B5T_04417 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:adi00194]
    B5T_04417 (atpD)
Enzymes [BR:adi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     B5T_04417 (atpD)
Photosynthesis proteins [BR:adi00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   B5T_04417 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFT72676
UniProt: K0CM01
Position
complement(4890879..4892264)
Genome map
AA seq 461 aa AA seqDB search
MSSGRIVQIIGAVIDVEFPRDNVPKVYDALTVDGTETTLEVQQQLGDGVVRSIAMGSTEG
LKRGLPVTDTGEAIQVPVGTKTLGRIMDVLGRPIDEAGPIGEEERMPIHRKAPTYADQAA
TNELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGFSVFAGVGE
RTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLFFV
DNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPAD
DLTDPSPATTFAHLDATVVLSRDIASKGIYPAIDPLDSTSRQLDPLVIGHEHYEAARGVQ
TVLQRYKELKDIIAILGMDELSEEDKLTVARARKIERFLSQPFFVAEVFTGSPGKYVSLK
DTIRSFTGILKGDYDHIPEQDFYMKGSIDEVVEAYNKRGGK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcggtcgtattgttcagatcatcggtgctgtgatcgacgtcgaatttccgcgc
gataatgtacccaaggtgtatgacgcgcttaccgtggacggcaccgaaaccacgctggaa
gttcaacagcagttgggcgacggtgtggtgcgctccatcgccatgggctccaccgaaggt
ctgaagcggggtctgcccgtgaccgataccggagaagcgattcaggttccggtcggcacc
aagaccctgggccggatcatggacgtgctgggacgccccatcgacgaggccggcccgatc
ggtgaagaggagcgtatgcccattcaccgtaaagcacctacttatgcggatcaggcagcc
accaacgaactgctggaaaccggtatcaaggttatcgacctggtttgccccttcgccaaa
ggcggtaaggtcggcctgttcggtggcgccggcgtgggcaagaccgtgaacatgatggag
ttgatccggaacatcgcgatcgagcactccggtttttccgtgttcgccggtgtgggggag
cgtacccgtgaaggtaacgacttctaccacgaaatgaaggactccaacgttctcgacaaa
gtatccctggtttacggtcagatgaacgagccgccgggtaaccgtctgcgtgtggcgctg
accggtctgaccatggccgagaagttccgggacgaaggccgtgacgtgttgttcttcgtc
gacaacatctaccgttacaccctggccggtaccgaggtgtccgcactgctgggccggatg
ccctccgcggtgggctaccagccgacgctggcggaagagatgggcgttctgcaggaacgg
atcacttccaccaagaccggctccattacctccgtgcaggcggtatacgtacccgcggat
gacttgaccgacccgtctccggccaccaccttcgcccacttggacgccaccgtggtactt
agccgtgacatcgcttccaagggtatttacccggcgatcgacccgctggattccacctcc
cgtcagttggatccgctggtgattggtcacgagcactacgaagccgcccgtggcgtgcag
actgttctgcagcgctacaaggagctcaaggacatcattgccattctcgggatggacgaa
ctgtccgaggaagacaagctcaccgtggcccgggcccgtaagatcgagcgctttctgtct
cagccgttcttcgtagcggaagtatttaccggttctccgggtaaatatgtgtccctgaag
gatactattcgctcctttaccggtatcctgaaaggcgactatgaccatatccccgagcag
gacttctacatgaaggggtccatcgatgaagttgtagaggcttacaacaaacgcggtggc
aagtaa

DBGET integrated database retrieval system