KEGG   Alcanivorax dieselolei: B5T_04421Help
Entry
B5T_04421         CDS       T02259                                 

Gene name
atpF
Definition
(GenBank) ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
adi  Alcanivorax dieselolei
Pathway
adi00190  Oxidative phosphorylation
adi01100  Metabolic pathways
Module
adi_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    B5T_04421 (atpF)
Photosynthesis proteins [BR:adi00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   B5T_04421 (atpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_B DUF4449 YMF19 DUF883 Apolipoprotein DivIVA V-ATPase_G vATP-synt_E DUF3552 REF V-ATPase_G_2 ESM4 FdhE LMBR1 HrpE
Motif
Other DBs
NCBI-ProteinID: AFT72680
UniProt: K0CJX8
Position
complement(4895321..4895791)
Genome map
AA seq 156 aa AA seqDB search
MNINLTLIGQAIWFALFVAFCMKFVWPPISRALEERKQKIAEGLSAADRAERDLELAQEK
ATANLKEAKEKAAEIIEQANRRANQIVDEAKDQARTEGERLIAKAQSEIEQEVNQAREQL
RKEVSALTLSGAEKVLGGEINRDTHKQLLDQLAAEL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaacctgacactgatcggccaggccatctggttcgctctgttcgtcgccttc
tgcatgaagttcgtctggccgcccatttcgcgggcgctggaagaacgaaaacagaagatc
gccgaaggcctgagtgccgctgatcgcgctgagcgtgatctggaattggcccaggaaaaa
gcgacggctaatctcaaggaagcaaaagagaaagcggccgaaatcattgagcaggccaac
cgccgagcaaatcagattgtggatgaggcaaaagatcaggcccgcaccgaaggtgagcgt
ctgattgccaaagcccagtccgagattgaacaggaagtcaatcaggctcgtgagcagctg
cgtaaggaagtgtccgcactgacgttgagcggtgccgagaaagtactcggcggcgaaatc
aaccgcgacactcacaagcagcttctggaccagttggcggctgaactctga

DBGET integrated database retrieval system