KEGG   Alcanivorax dieselolei: B5T_04422Help
Entry
B5T_04422         CDS       T02259                                 

Definition
(GenBank) ATP synthase subunit c 1
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
adi  Alcanivorax dieselolei
Pathway
adi00190  Oxidative phosphorylation
adi01100  Metabolic pathways
Module
adi_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    B5T_04422
Photosynthesis proteins [BR:adi00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   B5T_04422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_C
Motif
Other DBs
NCBI-ProteinID: AFT72681
UniProt: K0CM10
Position
complement(4895827..4896054)
Genome map
AA seq 75 aa AA seqDB search
MMEDINLLAAGIMAGLAALGAGIGFGLMGGRFLESVARQPELGPMLQTRMFIIAGLLDAV
PIIAVVLGMYLMFAA
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagatatcaaccttctcgctgctggcatcatggctggtctggccgcactgggc
gccggtatcggctttggtctgatgggcggtcggttcctggaatccgttgcgcgtcaaccc
gagctgggtccgatgctgcaaacccgcatgttcatcatcgcaggtctgttggacgccgtg
ccgattatcgctgtggtactgggtatgtatctgatgtttgcggcctaa

DBGET integrated database retrieval system