KEGG   Alcanivorax dieselolei: B5T_04429Help
Entry
B5T_04429         CDS       T02259                                 

Definition
(GenBank) Sodium/hydrogen exchanger family protein, putative
  KO
K11105  cell volume regulation protein A
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adi02000]
    B5T_04429
Transporters [BR:adi02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   B5T_04429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger CorC_HlyC TrkA_C
Motif
Other DBs
NCBI-ProteinID: AFT72688
UniProt: K0CJ84
Position
4902208..4903908
Genome map
AA seq 566 aa AA seqDB search
MDSLNLFLLIGTGLMFIGLLLGSLSTRIGVPSLLMFLLVGMAAGEDGIGGIEFDDLSTAY
VISNIALAVILMDGGLRTRMDTFRLALKPALSLASLGVAISAALVGAFTTWLMGVDWRLG
LLLGGIIGSTDAAAVFSVIKGAGVNINERVASTLEIESGLNDPMAIFITLMLVGVLVEPD
AAFGFGMILTLVQQFGLGAIIGLGLGAVLSEILLRVRSNEGLHALLLCSGGAMVFALTNL
AGGSGFLAIYLTGLVAGNRRGGTGDNVLRSMDSMAWLAQSGMFLMLGLLITPSELGQHLL
PALLVALFLMLVARPAAVWVSLIPFIFTWREKLFIAWTGLRGAVPIVLAVFPLLAGVGET
RLLFDITLVVVLISLLAQGASLRYMARLLKVSVPATASPKQMVPMAHSANRYLMQFEVEE
GAKAQGQRLGTITTQRITPILIIRDKTFLNLSEDPQIEAGDMVSWLAPLSEQDYLSDMCH
KITVAERRYFGDFIVRGSVPVDQLVAVYGIHELEEQLKGMTVEAAFEDHFGQHAVVGDTL
KLGGLRLRARTVEKGRVIMAGIKLPQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
ttggattcgttgaatctgtttctgctgatcggcaccggattgatgttcatcgggctgctt
ttgggctccctgagcacccgcatcggcgtaccgtccctgttgatgttcctgctggtgggg
atggccgccggtgaggatggcatcggcggtattgaattcgacgatctttccaccgcgtac
gttatcagtaacatcgccctggcggtcatcctcatggatggcggcctgcgcacccgtatg
gacacctttcgcctggccctgaagccggcgctgtccctggccagcctgggcgtggccatc
tccgccgccctggtcggcgccttcaccacctggctgatgggcgtggactggcgcctgggg
ctgctgttgggcggcattatcggctccaccgacgcggcggcggtattcagcgtgatcaag
ggcgccggggtcaatatcaatgagcgggtggccagcactctggaaatcgaatccggtctc
aacgacccgatggcgatcttcatcaccctgatgctggtcggcgtgctggtggagccggac
gccgcctttggcttcggcatgatcctgactctggtccagcagtttggcctgggggcgatc
atcggcctgggactgggcgcggtgctcagtgaaatcctgctgcgggtgcgcagcaacgaa
ggcctgcacgccttattactgtgcagcggcggtgccatggtattcgccctcaccaacctt
gccggcggcagcggcttcctggcgatctatctgaccggcctggtcgccggtaaccgccgt
ggcggtaccggggacaacgtgctgcgttccatggacagcatggcctggctggcccaatcc
ggcatgttcctgatgctgggtctgctgatcacaccatcggaactgggccagcacctgctg
ccggcgttgctggtggccttgttcctgatgctggtggcgcggccggcggcggtgtgggtg
agcctgattccctttattttcacctggcgcgaaaagctgttcatcgcctggaccggtctg
cgcggggcggtgcccattgtcctggcggtgttcccgctgttggcgggtgtgggcgagacc
cgcctgctgttcgatatcaccctggtggtggtattgatttcactgctggcccagggggcc
agcctgcgttacatggcacgattgttgaaagtctcggtaccagcgacggcgtcgccgaag
cagatggtgcccatggcgcactccgccaaccgctatctgatgcagttcgaggtggaggaa
ggcgccaaagcccagggccagcggcttggcaccattaccacccagcgcattaccccgata
ttgatcattcgggacaagacattcctcaatctgtccgaggatccgcagattgaagccggg
gacatggtcagttggttggcgccgctgagcgaacaggactatctgtcggacatgtgccac
aagatcaccgtggcggaaagacgctatttcggcgacttcatcgtgcgcggcagcgtgccg
gtggatcagttggtggcggtgtacggtatccatgaactggaggagcagctcaagggcatg
accgtggaagccgccttcgaggaccacttcggtcaacacgctgtggtgggtgacaccctt
aaactgggcggcctgagactgcgcgcccgcaccgtggaaaaaggacgggtgatcatggcg
ggcatcaaactgccgcaataa

DBGET integrated database retrieval system