KEGG   Alcanivorax dieselolei: B5T_04432Help
Entry
B5T_04432         CDS       T02259                                 

Definition
(GenBank) Haloacid dehalogenase-like hydrolase, putative
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AFT72691
UniProt: K0CM24
Position
complement(4906976..4907557)
Genome map
AA seq 193 aa AA seqDB search
MTEGPFTAVLFDLDGTLVDTRLDFAALRRELGFPEGIGVLEHLATLEDPEQAAWASTVID
RHEMEGASAATWIDGAQHVLETLHRNGVPTGILTRNSRAAVARTNAVLGLPVDLILTRED
CAPKPHPEGLLLIADYLGLRPASMVYVGDFVFDLQAARNAGMASGLLRNGKNRHFEDQAD
LVLDHLGEVLDWL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagggaccgtttacggcggtgttgtttgatctggacgggaccttggtggatacc
cgtctggattttgccgccttacggcgggagctggggtttcccgaaggcatcggcgtgctt
gagcacctggcgaccctggaagacccggagcaggcagcttgggcgagtacggtgattgat
cgccatgaaatggaaggggcgtcggcggccacctggatcgacggcgcacagcacgttctg
gaaacgcttcatcgaaacggtgtccccaccgggatcctcacccgtaacagccgggcggcg
gtggcacggaccaacgccgtgctggggttgccggtggacctgattctgacccgcgaggat
tgtgctccgaagccacatcccgagggcttgctgttgatcgctgattacctcggattgcga
ccggctagcatggtgtacgtcggggacttcgtcttcgatctccaggccgcccgcaatgcc
ggcatggcgtcgggattgttgcgcaatgggaagaatcgacacttcgaggaccaggcggat
ctggtgctggatcaccttggcgaggtgctggactggttgtaa

DBGET integrated database retrieval system