KEGG   Alcanivorax dieselolei: B5T_04434Help
Entry
B5T_04434         CDS       T02259                                 

Gene name
atfA1
Definition
(GenBank) Acyltransferase, WS/DGAT/MGAT subfamily
  KO
K00635  diacylglycerol O-acyltransferase / wax synthase [EC:2.3.1.20 2.3.1.75]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00561  Glycerolipid metabolism
adi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    B5T_04434 (atfA1)
Enzymes [BR:adi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     B5T_04434 (atfA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WES_acyltransf DUF1298 Condensation
Motif
Other DBs
NCBI-ProteinID: AFT72693
UniProt: K0CJ88
Position
4910345..4911718
Genome map
AA seq 457 aa AA seqDB search
MKSLSPVDQLFLWLEKRQQPMHVAGLQLFSFPEDAGPKYVSELAQSIRDYCCPEPPFNQR
LTRRFGQYFWTEDKQFDIDHHFRHEALPKPGRIRELLSLVSAEHSNLLDRERPLWEAHLI
EGIRGRQFALYTKVHHSVVDGISAMRMGMRALSKDPQERDLPPVWAYKPEKKQRSLPSNP
VDAMSSLARLTAGVSKQVATVPALARELYKVGQKAKTDPNYVSIFQAPDTMFNQCITGSR
RFAAQSFALPRLRKLAGTFNCTINDLVLSMCGHALREYLISQNALPDQPLIAMVPLSLRK
DDSAGGNQIALILANLGTHVCDPANRLRIVQASVKDAKRRFAQMSPEEILNFTALSMTPT
GLNLLTGLAPKWRAFNVIISNVPGPREPLYWNGARLRGMYPVSVVLDRIALNITLTSYQD
QLEFGLIACRRTLPSMQRLLDYLENSIRELEIAAGFK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactgagtcccgtggaccagctctttctgtggctggagaagcgccagcaaccc
atgcacgtggccgggttgcagttgttctcgtttcccgaggatgccgggcccaagtacgtc
agcgaactggcccagtcgatccgcgactattgctgtcccgagcccccgttcaatcagcgt
cttacccgtcgtttcggccagtatttctggaccgaggacaagcagttcgacatcgatcat
cacttccgccacgaagcgctgcccaaacccggccgcattcgtgagctgctgtcgctggtg
tccgccgaacactccaacctgctggaccgggaacggccgctgtgggaggcccatctgatc
gaaggcatccgcgggcgccagtttgccctctacaccaaggtgcaccattccgtggtcgat
ggcatctccgccatgcgcatgggcatgcgggcgctgtccaaggatccgcaagagcgggac
ctgccgccggtgtgggcctataaacccgagaaaaaacaacgctctctgcccagcaatccg
gtggacgccatgagcagcctggcgcgcctgaccgccggcgtgagcaagcaggtggccacg
gtgccggcgctggcgcgggaactgtacaaggtcggccagaaagccaagaccgacccgaac
tacgtgtccatcttccaggcgccggataccatgttcaatcagtgcatcaccggctcccgt
cgtttcgccgcgcaaagctttgccctgccccgtctgcgcaagctggccggcactttcaac
tgcaccatcaatgatctggtattgagcatgtgcggccacgcactgcgtgaatacctgatc
agccagaacgcgctgccggaccagccgttgatcgccatggtgccgctctccctgcgcaag
gacgacagcgccggcggcaatcagattgccttgattctggccaatctgggcacccatgtg
tgcgatccggccaatcgcctgcgcatcgtccaggcctcggtaaaagacgccaaacggcgc
tttgcccaaatgagcccggaggaaattctcaatttcaccgccctgagcatgacccccacc
ggtctgaacctgctcaccgggcttgcaccaaaatggcgcgcgttcaatgtgattatctcc
aacgtccccgggccgcgggagccgttgtattggaacggcgcccgcctgcgcggcatgtac
ccggtatcggtggtactggaccggatcgccctcaatatcaccctgaccagctaccaggat
cagctggaattcggcctgatcgcctgtcgccggaccctgccctccatgcagcgcctgctg
gattatctggaaaattcgatacgggaactggagatcgccgccggtttcaaatag

DBGET integrated database retrieval system