KEGG   Alcanivorax dieselolei: B5T_04436Help
Entry
B5T_04436         CDS       T02259                                 

Definition
(GenBank) Glutathione S-transferase
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3
Motif
Other DBs
NCBI-ProteinID: AFT72695
UniProt: K0CK12
Position
4912315..4912650
Genome map
AA seq 111 aa AA seqDB search
MTITLYGGEVSYFTGKVRAYLRWADLPFEEVIASADVYGQVILPSVGIPVIPVLRTQSGE
ILQDTTVITEGRRAACTDKRREPCFPANQTTPCRNIASATRTKPATLAPWT
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaccctgtatggcggtgaagtcagctatttcactggcaaagtccgcgcctac
ctgcgttgggcggatcttccgttcgaggaagtgatcgccagtgccgacgtttacggacag
gtcattctcccctccgtgggaataccggtgattccggtactgcgcacccaaagcggcgag
atcctgcaagacaccacggtcatcactgaaggccgccgcgccgcttgtactgacaagcgg
cgcgagccctgctttcccgcgaatcagaccacgccctgtcgcaacatcgcttccgccacc
cgcacgaagccggccacactggcgccctggacataa

DBGET integrated database retrieval system