KEGG   Alcanivorax dieselolei: B5T_04438Help
Entry
B5T_04438         CDS       T02259                                 

Definition
(GenBank) Glutamate dehydrogenase (NADP)
  KO
K00262  glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00220  Arginine biosynthesis
adi00250  Alanine, aspartate and glutamate metabolism
adi00910  Nitrogen metabolism
adi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    B5T_04438
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B5T_04438
   00220 Arginine biosynthesis
    B5T_04438
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     B5T_04438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N
Motif
Other DBs
NCBI-ProteinID: AFT72696
UniProt: K0CM31
Position
complement(4912578..4913912)
Genome map
AA seq 444 aa AA seqDB search
MDIDTLIKGLREKDPHQTYFHQAAGGLLEGLGPFLRNHPRYADPSLFARLFEPERVIIFR
VPWVDDQGRVQVNRGFRVQMNGSLGPYKGGLRFHPSVNLDVLRFLALEQTIKNALTDLPL
GSGKGGADFDPHGRSDGEIMRFCQAFMAELFDHIGSDVDVPAGDIGVGAREIGYLFGMYR
KLHRSHDSGAITGKSPVFGGSLLRTEATGYGLVYFLQYMLQERDEELEGRRVAVSGAGNV
ARYAAEKVLIEGGIVISLSDSRGALHAANGLTREHLETLDRIQAGGGRLHQLPDHHAELT
YQEGIKPWRFPCDIALPCATQNELNEQDARALVDNGCRWVAEGANMPTTTEAVSYLVGHG
VGYAPGKAANAGGVAVSGLEMSQNSLRHPWSREEVDRRLHDIMSRIHHKCLEYGGQDERP
DYVQGASVAGFVRVAEAMLRQGVV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgataccctgatcaagggactgcgggagaaagatccccatcagacctatttt
caccaggcggctggcggcttgctggaagggctggggccgttcttgcggaaccatccccgc
tacgcggatcccagtttgttcgcccggctgttcgagccggagcgcgtcatcattttccgc
gtgccctgggtggatgatcagggacgggtgcaggtgaaccgcggcttccgtgtgcagatg
aacggttctcttggcccttacaagggcgggctgcgcttccatccgtcggtgaatctcgat
gtcctgcgtttcctggctctggaacagaccatcaagaacgcgttgaccgatctgccgctg
ggttccggcaagggcggcgcggatttcgatcctcatggccgttccgatggtgagatcatg
cgtttctgtcaggcgttcatggcagagctgtttgaccacatcggcagcgacgtggacgtg
ccggccggtgatattggtgtcggcgcccgggaaatcggttatctgttcggtatgtatcgc
aaacttcatcgctcccatgacagcggcgcgatcaccggcaagtcgccggtcttcggcggc
agcctgctgcgcaccgaggccaccggttatggactggtttattttctgcaatacatgctg
caagagcgggatgaggagctggagggtcgccgggtggcggtgtccggggcgggtaatgtg
gcccgatacgcggcggagaaagtgctgattgagggaggcatcgtcatcagtctgtcggat
tcacgtggtgccttgcacgccgccaacggactgactcgcgagcacctggaaaccctcgac
cggatccaggcagggggcggccggctgcatcagttacccgatcaccatgcggagctcacc
tatcaggagggcatcaaaccgtggcgcttcccctgcgatatcgccttgccgtgcgccacc
cagaatgagctgaacgaacaggacgctcgtgctttggtggacaacggctgtcggtgggtg
gcggagggtgcgaacatgcccaccaccacggaagcggtgtcctacctggttggccatggc
gtcggctatgcgccgggcaaggccgccaatgccggtggtgtagcggtaagcggattggag
atgagtcagaacagcctgcgtcacccctggagccgtgaagaagtggatcggcggctgcat
gacatcatgtcgcgcattcaccacaagtgcctagaatatggtggccaggacgagcgcccg
gattatgtccagggcgccagtgtggccggcttcgtgcgggtggcggaagcgatgttgcga
cagggcgtggtctga

DBGET integrated database retrieval system