KEGG   Alcanivorax dieselolei: B5T_04439Help
Entry
B5T_04439         CDS       T02259                                 

Definition
(GenBank) hypothetical protein
  KO
K07043  uncharacterized protein
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    B5T_04439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF45 WLM SprT-like
Motif
Other DBs
NCBI-ProteinID: AFT72697
UniProt: K0CLP6
Position
complement(4913930..4914592)
Genome map
AA seq 220 aa AA seqDB search
MDYQLVRSKRRTLALRVAPDGQIEVRAPLRLGRRHIDDFVREHQDWIRRQQDYWRTRPRQ
HWRDGDTVPHLGRPVRLNLVEAARTRVGLEHDTLTVAMPLPASEEAVREAVEAWWRRLAR
GEFLRSIERQFHWFAARGHGAPVLRIKKMRTRWGSLSQRGYINLNLALMRYDLEVIDYVV
MHELCHLEYAHHGPQFHALMDRRMPDWRRRKQRLDQFLPE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggattatcaactggttcgctccaagcgacgcacactggctttacgagtggcgcccgac
ggccagatcgaggtccgtgcgccgttgcgccttggccgtcggcatattgatgacttcgtg
cgcgaacatcaggattggattcggcgccagcaggattattggcgcacgcgtccgcgccag
cattggcgcgatggtgacaccgtgccccacctggggcggccggttcgtctgaatctggtc
gaagcggccagaacccgggtggggttggagcacgatactctgaccgtggcgatgccgctg
ccggcgtcggaagaggcggtcagggaagcggtggaagcctggtggcggcggctggcgcgt
ggcgaattcctgcgcagcatcgagcggcaattccactggttcgccgcccgaggccatggc
gcgccggtactaaggatcaagaaaatgcgcacccgctggggttccttgtcccagcggggg
tacatcaatctgaatctggcgctgatgcgctatgaccttgaggtgatcgactacgtggta
atgcacgaactttgtcacttggagtacgcccatcatggaccgcaattccatgccttgatg
gaccgacggatgccggactggcgtcgacgaaaacaacgattggatcaatttttgcctgaa
taa

DBGET integrated database retrieval system