KEGG   Alcanivorax dieselolei: B5T_04440Help
Entry
B5T_04440         CDS       T02259                                 

Definition
(GenBank) RND transporter, HAE1/HME family, permease protein
  KO
K18138  multidrug efflux pump
Organism
adi  Alcanivorax dieselolei
Pathway
adi01501  beta-Lactam resistance
adi01503  Cationic antimicrobial peptide (CAMP) resistance
Module
adi_M00647  Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:adi00001]
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    B5T_04440
   01503 Cationic antimicrobial peptide (CAMP) resistance
    B5T_04440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adi02000]
    B5T_04440
   01504 Antimicrobial resistance genes [BR:adi01504]
    B5T_04440
Transporters [BR:adi02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   B5T_04440
Antimicrobial resistance genes [BR:adi01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    B5T_04440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SUR7
Motif
Other DBs
NCBI-ProteinID: AFT72698
UniProt: K0CJ94
Position
complement(4914628..4917729)
Genome map
AA seq 1033 aa AA seqDB search
MILSDVSIKRPVFATVISLLIVVFGISALMKLPVREYPDIDPPEVSVAVEYPGAAPEVID
TQIIQVIEGAIAGVEGVRRIESRSRRGSARTSVEFNLERDLDVAANDVRDAVSRVLNRLP
EEAEAPVIAKTDADARPIMWVTLSSNSLAPQELTDFAERSLVDRFAVLGGVSEVIIGGER
RYAMRVWLDRQRMAANDVTVTDIYNALRANNVELPAGRLDSDSRSFTVRADSRLGSVAEF
NHMVVHRQGDYLLRLGDVARVALGVENDDTVLRANGQTAIGLGVVRQSKANTVTVSNNVR
EEIEAVSNNLPDDIRLDVSHDESLFIRASIREVLVTLAMSVTLVILVIFVFLGNLRATLI
PAVTIPVSIVGAFIGLGILGFSINVLTLLALILAIGLVVDDAIVMLENIQRRIDEGESRL
VAAFLGARQVAFAVVATTATLVAVFVPISFMGGDVGRLFGEFGFTLAVAVIISSIVALSL
APMLCSRWLHAHTPEEEQQEQNNLLNRALNGLNRAYATRLGKTLKRPAPVVVISVLICVA
AGLVFSQLSRELAPTEDRGVFIVSANAPQGSSTAYASHHIQKVEEKLLPLIENGLAVRVL
SIVGFRGQTERGFSIVRLEPWEDRNRSQQDIVNDIRGEVTTVPGLRVFAVNPPGLGQSGF
DQELEVVIGGQDYDSVVGWSETLRAAMAANPNLLSVDTDYEETQPQVEVVINRDRAADFG
ISAAEVGQTLQAMFATLTASTYIDRGREYDVLLEAREQDARIPEDINSVYVRTAAGDLVP
LSSLVELRTLGAAPELRRLDRLPAVTLSANLAPGYDLGSALDFIEQTVRETLPLEARLSY
KGIAQEFTEASAAILITFLLALVIVFLVLAAQFESWIHPLIIMLTVPLAIAGAILALRVT
GNSLNIYSQIGMVMLVGLMAKNGILIVEFANQLRDQGLAVRDAVYQGAILRFRPVLMTGI
STIFGAVPLVLASGAGAESRMTIGVVILGGLLFATVLTLFIIPVLYLWLAPYARPADAVA
QQLASEMQQETDR
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcagcgatgtctctatcaagcgtccggtgttcgccaccgtgatcagtctgctg
atcgtggtgttcggcatcagtgccttgatgaagctgccggtgcgggagtatccggacatc
gatccccctgaggtatcggtggcggtggagtacccgggggcggcaccggaggtcatcgat
acccagatcattcaggtcatcgaaggggccatcgccggggtggaaggcgtgcgccgcatc
gaatcccgttcccgccggggttccgcccgcacttcggtggaattcaatctggaacgggat
ctggacgtcgccgccaacgatgttcgcgacgcggtgtcgcgggtgctcaatcgcctgcca
gaggaagcggaagcgccggtgatcgccaagaccgacgccgatgcccggcccatcatgtgg
gtcacgctcagcagtaacagcctggcgccgcaggaactgaccgatttcgccgaacgctcc
ctggtggaccgtttcgccgttctgggcggggtttccgaagtgatcatcggcggtgaacgc
cgctatgccatgcgggtatggctggatcggcaacgcatggccgccaacgatgtcacggtc
accgatatctataacgccctgcgcgccaataacgtggaattaccggccggccgtctcgac
tccgacagtcgcagcttcaccgttcgtgctgatagccggcttggctcggtggcagagttc
aaccacatggtggtgcatcgccagggcgattatctgttgcggctgggggatgtggcgcgg
gtggcgctgggtgtggagaacgacgacaccgtgttgcgcgccaacggccagaccgccatc
gggctcggggtggtgcgccagtccaaggccaataccgtcaccgtttccaacaacgtccgc
gaagaaatcgaggcggtgagcaataacctgcccgatgacatccgcctggatgtgagtcac
gacgagtctctgtttattcgcgcttccatcagggaagtgctggtgacgctggcgatgagc
gtgacgctggtgatcctggtgattttcgttttcctgggaaatctgcgtgccacgctgatt
ccggcggtcactattccggtgtccatcgttggggcgtttattggcctgggaattctcggg
ttctcaatcaatgtgctgacgttgttggcgctgattctggccatcggcctggtggtggac
gatgccatcgtcatgctggagaacatccagcggcgcatcgatgaaggcgagagccgtctg
gtggccgccttcctgggagcccggcaggtcgctttcgcggttgtcgccaccaccgccact
ctggtggcggtctttgtgccgatctcattcatgggcggggatgtcgggcgcctgttcggt
gagttcggctttaccctggccgtggcggtgatcatttccagcatagtggcgttgtccctg
gcccccatgctgtgttcccgctggctgcacgcgcatactccggaagaggaacagcaggaa
cagaacaatctgctcaaccgcgcgctgaatgggctgaaccgggcttacgcaacgcgactg
gggaaaaccctgaagcgacccgctcccgttgtggtgatctcggtgttgatctgcgtggcg
gcggggctggtattcagccagttatcccgggagctggcccccaccgaggaccggggcgtg
ttcatcgtgtcggcgaatgccccgcagggatccagcaccgcttacgccagtcaccatatc
cagaaggtggaagaaaaactgctgcccttgatcgaaaacgggctggcggttcgggtgttg
tccattgtcggtttccgcggacagaccgagcgcgggttcagtatcgtgcggctggagccc
tgggaggaccggaaccggagccagcaggacatcgttaacgacatccgcggcgaagtcacc
accgtgcccggcctgcgcgtgtttgccgttaacccgccggggctgggacaaagcggcttc
gatcaggaattggaagtggtgatcggcgggcaggattacgattccgtggtgggctggagc
gaaaccctgcgcgccgcgatggccgccaaccccaatctgttgagcgtggataccgattac
gaggaaacccagccgcaggtggaagtggtgatcaatcgggaccgggcggcggacttcggc
atttccgccgctgaagtggggcagaccctgcaagccatgttcgccaccctgacggcctcg
acttatatcgaccggggccgtgaatacgatgttcttttggaagcgcgggaacaggatgcc
cgcatcccggaggacatcaattcggtttatgttcgcaccgccgccggcgacctggtgccg
ctgtccagcctggtggagctgcgcacccttggggcggcgccggaactgagacggctggac
cgtctgccggcggtgacgctttcggcgaatctggcccccggttatgacctgggcagtgcg
ctggatttcattgagcagacggtgcgggaaaccctgccgctggaagcgcgtctgagctac
aagggtattgcccaggaattcaccgaggcttccgcggcgatcctgatcacgttcctgctg
gcgctggtgatcgtctttctggtgctggcggcgcaattcgaaagctggatacatccgctg
attatcatgctgacggtgcccctggcgatcgccggcgccattctggcattgcgcgtgacc
ggcaacagcctgaatatctacagtcagatcggcatggtgatgctggtggggctgatggcc
aagaacggtattcttatcgtcgaattcgccaatcagttgcgcgaccaggggctggcggtg
cgtgacgcggtctatcaaggcgcgattctgcgcttccggccagtgttgatgaccggtatt
tccaccatctttggcgcggttcctctggtgctggccagcggcgccggcgcggaaagtcgc
atgaccatcggcgtggtgattctcggcggcctgctgttcgccaccgttctcaccctgttc
atcattccggtgctttatctgtggctggctccctacgcccgcccggcggacgcggtggct
cagcagctggcgtcggaaatgcaacaagaaacggatcgctga

DBGET integrated database retrieval system