KEGG   Alcanivorax dieselolei: B5T_04442Help
Entry
B5T_04442         CDS       T02259                                 

Gene name
alkK
Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
adi  Alcanivorax dieselolei
Brite
Enzymes [BR:adi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     B5T_04442 (alkK)
Lipid biosynthesis proteins [BR:adi01004]
 Acyl-CoA synthetase
  Unknown
   B5T_04442 (alkK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Prot_ATP_ID_OB DUF3299
Motif
Other DBs
NCBI-ProteinID: AFT72700
UniProt: K0CK21
Position
complement(4919088..4920722)
Genome map
AA seq 544 aa AA seqDB search
MSNDLTIQRTAEAVESPLLINSILEAGVRNAPDQEIVYADQRRMTYREMGERVARLASAL
QQQGVKPGDTVAVMDWDTHRYLEAFFAVPMMGAVLHTVNVRLSPEQILYTINHAEDDVIL
VNREFLPVLDQIKDRIETVKTYILLDDEGGDTDTAIDLAGEYEALVAQASAQFDFPELDE
NTRATTFYTTGTTGLPKGVYFSHRQLVLHTFAGRAALTGTGHGRFNQNDVYMPITPMFHV
HAWGVPFVATLLGVKQVYPGRYVPETLLKLLLTEKVTFSHCVPTIIQMLLQSEAVKSIDL
SGWKVIIGGSALPKPLAQSALERGIDIYSGYGMSETCPLISLALLTPELEQADLETQADY
RTRTGRPVPMVQWRIVDGDMNDVPHDGKSQGELVLRAPWLTQGYLKDESNSQELWRGGWM
HTGDIGVIDADGWLKITDRIKDVIKTGGEWVSSLDLESLILQHDAVRECAVVGVPDEKWG
ERPVALVVKGADVEAQPIIDMVAGYAEKGMISRYGIPDRVVFVEELPRTSVGKLDKKKMR
AELV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgatctgaccatccagcgtaccgcggaagccgtggaatcaccgctcttgatc
aacagtatcctggaggccggcgttcgcaacgcacccgatcaggaaatcgtctacgccgat
cagcggcggatgacctatcgggaaatgggggagcgggttgctcgtctcgccagtgccttg
cagcaacaaggggtgaagcccggtgacactgttgcggtgatggactgggatacccaccgt
tatctggaagctttcttcgccgtgccgatgatgggcgcggtgctgcacaccgtgaacgtg
cgtctgagcccggagcagattctctacaccatcaaccacgccgaggatgatgtgattctg
gtgaaccgggaattcctgccggtgctggatcagatcaaggaccgtatcgagacggtcaag
acttacatcctgctggatgacgagggcggcgataccgacaccgccatcgatctggccggt
gagtacgaggcgctggtggcccaggcttccgcgcaattcgatttcccggagctggatgag
aatacccgtgccaccacgttctacaccacgggtaccacgggcctgcctaaaggcgtgtac
ttctcccaccggcaactggtactgcacacctttgccggtcgtgccgctctgaccggtacc
ggtcacggccgtttcaatcagaacgacgtgtacatgccgatcacgccgatgttccacgtg
cacgcctggggtgtgccgttcgtcgccactttgctgggcgtgaagcaggtttatccgggc
cgttatgtgccggaaaccctgctcaagctgttgctcaccgagaaagtgaccttctcccac
tgcgtgcccaccattatccagatgttgctgcagtcagaagcggtgaagagcatcgatctg
agcggctggaaggtaatcattggcggttccgcgttgcccaagccgctggcgcaaagcgcc
ctggagcgcggcatcgacatctacagcggttacggcatgagcgagacctgcccgctgatc
tccctggcactgctgacgccggaactggaacaggccgacctggaaacccaggcggattac
cgcacccgcaccggccgcccggtccccatggtgcaatggcgcatcgtcgacggggatatg
aacgatgtgccccatgacggcaagtcccagggcgagctggtgctgcgcgccccctggctg
acccaggggtacctgaaggacgagtccaactctcaagagttgtggcgcggcggctggatg
cataccggggatatcggcgtgattgacgccgacggctggctgaaaatcaccgaccgcatc
aaggacgtgatcaagaccggcggtgaatgggtatcttccctggatctggagagcctgatt
cttcagcacgacgccgtgcgcgagtgcgcggtggtgggcgtgccggacgagaaatggggc
gagcgtccggtggcgctggtggtcaagggcgccgacgtggaagcgcagccgatcatcgat
atggtggccggttacgctgagaagggcatgatcagccgctatggcatcccggatcgcgtg
gtgttcgtggaggagctgccgcgcacctccgtgggcaaactggacaagaaaaagatgcgc
gcggaactggtctga

DBGET integrated database retrieval system