KEGG   Alicycliphilus denitrificans K601: Alide2_0223Help
Entry
Alide2_0223       CDS       T01463                                 

Definition
(GenBank) 3-hydroxyisobutyrate dehydrogenase
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00650  Butanoate metabolism
adk01100  Metabolic pathways
adk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Alide2_0223
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     Alide2_0223
    1.1.1.373  sulfolactaldehyde 3-reductase
     Alide2_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 2-Hacid_dh_C F420_oxidored NAD_binding_10 3HCDH_N UBA
Motif
Other DBs
NCBI-ProteinID: AEB82654
UniProt: F4GED9
Position
complement(254064..254954)
Genome map
AA seq 296 aa AA seqDB search
MKAGFIGLGRMGFALASHLLRNGVQLAVHDIQSAPVDKLVALGASRAASVQALAAGADVV
FTMLPGPKQSREVILGKGGVLAGLRRGGCLVELSTIDTDTVDALAAAAEKQGVRFADAPV
GRLAAHADRGESLFMLGAHDADRGALEPLLLKMGTTVLHCGAPGSGTRMKLINNLMVLCY
CQLNSEALVLAGALGLDARKTFDVLTGTTASNGQLKEKWPVKVLAGDLTPGFDIALGFKD
LTLACQAAQSAGVSLPMGNLARSLFQLARHAGKDGQDTSCMTDFWAESNGQPPVRL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccggattcatcggcctgggccgcatgggcttcgccctggcctcccacctgctg
cgtaacggcgtgcagctcgcggtgcacgacatccagagcgcgcccgtggacaagctcgtg
gccctgggcgcatcgcgcgcggccagcgtgcaggcgctggccgccggcgcggacgtggtg
ttcaccatgctgcccggcccgaagcagtcgcgcgaggtgatcctgggcaagggcggcgtg
ctggccgggctgcgcaggggcggctgcctcgtcgagctcagcaccatcgacaccgacacg
gtggacgcgctggccgctgccgccgagaagcagggcgtgcgcttcgccgacgcgcccgtg
gggcgcctggcagcgcacgccgaccggggcgagtcgctgttcatgctgggcgcccacgat
gccgaccgcggcgcgctggagccgctgctgctcaagatgggcaccacggtgctgcactgc
ggcgcgccgggcagcggcacgcgcatgaagctcatcaacaacctcatggtgctgtgctac
tgccagctcaactccgaggcgctggtgctcgccggcgcgctggggctggacgcgcgcaag
accttcgatgtgctcacgggcaccacggcatccaacgggcagctcaaggagaagtggccc
gtgaaggtgctcgcgggcgacctcacgccggggttcgacatcgcgctgggcttcaaggac
ctgacactcgcctgccaggccgcgcagtcggcgggcgtgtcgctgcccatgggcaacctc
gcgcgcagcctgttccagcttgcgcggcacgcgggcaaggacgggcaggacacctcgtgc
atgaccgatttctgggccgagtccaacggacagcccccagtccggctgtga

DBGET integrated database retrieval system