KEGG   Alicycliphilus denitrificans K601: Alide2_0283Help
Entry
Alide2_0283       CDS       T01463                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00362  Benzoate degradation
adk00620  Pyruvate metabolism
adk00621  Dioxin degradation
adk00622  Xylene degradation
adk00650  Butanoate metabolism
adk01100  Metabolic pathways
adk01120  Microbial metabolism in diverse environments
adk01220  Degradation of aromatic compounds
Module
adk_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alide2_0283
   00650 Butanoate metabolism
    Alide2_0283
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Alide2_0283
   00622 Xylene degradation
    Alide2_0283
   00621 Dioxin degradation
    Alide2_0283
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Alide2_0283
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Alide2_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEB82711
UniProt: F4GF60
Position
312466..313380
Genome map
AA seq 304 aa AA seqDB search
MNQKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPESDGLKRAREMGIKTTHEGVD
GLVPHMKQDGVQIVFDATSAYVHAENSRKVNAQGALMIDLTPAAIGPYCVPPVNLKEHLG
RGETNVNMVTCGGQATIPMVVAVSRVQPVAYGEIVATVSSRSAGPGTRKNIDEFTRTTAG
AIEKVGGAKKGKAIIVINPADPPLIMRDTVHCLTEEEPDREAITQSIHAMLAEVQKYVPG
YKLVNGPVFDGKRVSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEMLAGRLAFQ
PVAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaaaatcaaatgcgccctgatcgggcccggcaacatcggcaccgacctgctc
gccaagctgcagcgcagcccggtgctggaacccgtgtggatggtgggcatagaccccgag
tccgacggcctcaagcgcgcgcgcgagatgggcatcaagaccacgcacgagggcgtggac
ggcctggtgccgcacatgaagcaggacggcgtgcagatcgtcttcgacgccaccagcgcc
tacgtgcacgccgagaactcgcgcaaggtgaatgcgcagggcgcgctcatgatcgacctc
acgcccgccgccatcggcccgtactgcgtgccgcccgtgaacctgaaggagcacctgggc
cgcggcgagaccaacgtcaacatggtcacctgcggcggccaggccaccatccccatggtg
gtggcggtaagccgcgtgcagcccgtggcctacggcgagatcgtggccaccgtctccagc
cgctccgccggcccgggcacgcgcaagaacatcgacgagttcacgcgcaccaccgccggc
gccatcgagaaggtgggcggcgcgaagaaaggcaaggccatcatcgtcatcaacccggcc
gacccgccgctcatcatgcgcgacaccgtgcactgcctgaccgaggaggagccggaccgc
gaggccatcacgcaaagcatccacgccatgctggccgaggtgcagaaatacgtgcccggc
tacaagctggtgaacggcccggtgttcgacggcaagcgcgtctcggtgttcctggaggtc
gagggcctgggcgactacctgcccaagtacgccggcaacctggacatcatgaccgccgcc
gccgcgcgcaccgccgagatgttcgccgaggaaatgctcgccggccgcctcgccttccaa
cccgtggctgcatga

DBGET integrated database retrieval system