KEGG   Alicycliphilus denitrificans K601: Alide2_0743Help
Entry
Alide2_0743       CDS       T01463                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00230  Purine metabolism
adk00240  Pyrimidine metabolism
adk00760  Nicotinate and nicotinamide metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Alide2_0743
   00240 Pyrimidine metabolism
    Alide2_0743
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Alide2_0743
Enzymes [BR:adk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Alide2_0743
CD molecules [BR:adk04090]
 Proteins
  Alide2_0743
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:adk00537]
 Enzymes
  Alide2_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-nucleotidase DUF4936
Motif
Other DBs
NCBI-ProteinID: AEB83159
UniProt: F4G6Z3
Position
complement(779971..780903)
Genome map
AA seq 310 aa AA seqDB search
MALTLDDKLVVAISSRALFDFEEENRIFEHGDDRAYVALQLARLDVPAPPGVAFSLVRKL
LAFNGAEHQRVEVVLLSRNDPVSGMRVFRSCQAHGLPSVQRGVFTQGRDPFRYLRPLGAH
LFLSANETDVRSALHLGYPAARVLTESVQAGDAHPHEVRIAFDGDAVLFSDEAERVYQSE
GLAAFQRHERDKAAQPLPEGPFKPLLAALHRLQQAGSADMRIRTALVTARSAPAHERAIR
TLMDWNITVDEAMFLGGLPKGEFLREFEPDFFFDDQTGHVDSAARHVPAGHVSSGIANAA
AGAVQAAQAP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccctgaccctggacgacaagctcgtcgtcgccatctcctcgcgcgccctgttcgac
ttcgaggaggagaaccgcatcttcgagcacggcgacgaccgcgcctacgtggccctgcag
ctggcgcgcctggacgtgcccgcacctccgggcgtggccttctcgctggtgaggaagctt
ctggccttcaacggcgccgaacaccagcgcgtggaggtggtgctgctgtcgcgcaacgac
ccggtgagcggcatgcgcgtgttccgctcctgccaggcccacggcctgcccagcgtgcag
cgcggcgtgttcacgcaggggcgcgatccgttccgctacctgcggccgctgggcgcgcac
ctgttcctatcggccaacgagacggacgtgcgctcggccctgcacctgggctaccccgcg
gcgcgcgtgctcaccgagtcggtgcaggcgggcgacgcccatccgcacgaggtgcgcatc
gccttcgacggcgacgcggtgctgttctccgacgaggccgagcgcgtctaccagtccgag
ggcctcgcggctttccagcgccacgagcgcgacaaggccgcccagccactgcccgagggc
cccttcaagccgctgctggcggccctgcaccggctgcagcaggcgggcagcgcggacatg
cgcatacgcacggccctggtgacggcgcgcagcgcgcccgcgcacgagcgcgccatacgc
acgctgatggactggaacatcaccgtggacgaggccatgttcctgggcggcctgcccaag
ggggagttcctgcgcgagttcgagcccgacttcttcttcgacgaccagacaggccacgtc
gattcggccgcgcgccacgtgccggccggccatgtgagcagcggcatcgccaacgccgca
gccggggccgtgcaggcggcccaggcgccgtag

DBGET integrated database retrieval system