KEGG   Alicycliphilus denitrificans K601: Alide2_0971Help
Entry
Alide2_0971       CDS       T01463                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00010  Glycolysis / Gluconeogenesis
adk00071  Fatty acid degradation
adk00350  Tyrosine metabolism
adk00625  Chloroalkane and chloroalkene degradation
adk00626  Naphthalene degradation
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_0971
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Alide2_0971
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Alide2_0971
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Alide2_0971
   00626 Naphthalene degradation
    Alide2_0971
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Alide2_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 PglD_N
Motif
Other DBs
NCBI-ProteinID: AEB83379
UniProt: F4G9G4
Position
1014693..1015760
Genome map
AA seq 355 aa AA seqDB search
MISYDVAECGQPLVRNERATPRPVGDQVLVRVEAAGVCHSDLHIWHGSYDLGNGKKMSMI
DRGMKLPLTMGHEIAGEVVAVGDAVKDVAVGKRYLVFPWHGCGECSVCRRGDENLCLAGR
SMGVFQPGGYADHVLVSHSRYLVDIGDMPPVHAAPYACSGLTTYSALKKIPAQVLKDEKL
IIFGAGGLGLMAILLARAMGSAGVIVIEPDAAKRAAALQAGALAAFDPGQDGYMAQVRQA
AGGAVWAIIDCVGSSQTVQAGIDMLTKGGQLVQIGLFGGHVDLPTPSMALRAITYQGTYV
GNLRELQELMQLVKDKRLQPVPSTCLPFGKAFTALLALEEGKAVGRQILTPEGAC
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctatgacgtggccgaatgcggccagcccctggtgcgcaacgagcgcgccacc
ccccggcccgtgggcgaccaggtgctggtgcgcgtcgaggcggcgggggtgtgccactct
gacctgcacatctggcatggctcgtacgacctgggcaacggcaagaagatgtccatgatc
gatcgcggcatgaagctgcccctgaccatgggccacgagatcgccggcgaagtggtcgcc
gtgggcgatgccgtgaaggacgtggcggtgggcaagcgctacttggtcttcccctggcac
ggctgcggggaatgcagcgtgtgccggcgcggggacgagaacctgtgcctggccggccgg
tccatgggcgtgttccagccgggcggctatgccgaccatgtgctggtgtcccactcgcgc
tatctggtggacatcggcgacatgccgcccgtgcatgcggcgccctatgcgtgttcgggc
ctgaccacctacagcgccctgaagaagatacccgcccaggtgctcaaggacgagaagctc
atcatcttcggcgccggcggcctgggcctgatggccatcctgctcgcgcgggccatgggc
agcgcgggcgtgatcgtcatcgagcccgacgcggccaagcgtgccgccgccctgcaggcc
ggcgccctggcggcgttcgatcccgggcaggacggctacatggcccaggtgcgccaagcc
gcgggcggcgcggtgtgggccatcatcgactgcgtgggttccagccagaccgtgcaggcc
ggcatcgacatgctgaccaagggcgggcagctggtgcagataggcctgttcggcggccac
gtggacctgcccacgccctccatggccctgcgcgccatcacctaccagggcacctacgtg
ggcaacctgcgcgagctgcaggagctgatgcagctggtcaaggacaagcggctgcagccc
gtgcccagcacctgcctgcctttcggcaaggccttcaccgccctgctggcgctggaggag
ggcaaggccgttgggcggcagatcctgacgccggagggcgcctgctga

DBGET integrated database retrieval system