KEGG   Alicycliphilus denitrificans K601: Alide2_1299Help
Entry
Alide2_1299       CDS       T01463                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00260  Glycine, serine and threonine metabolism
adk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01130  Biosynthesis of antibiotics
adk01230  Biosynthesis of amino acids
Module
adk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide2_1299
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alide2_1299
Enzymes [BR:adk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alide2_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AEB83703
UniProt: F4GD20
Position
complement(1360072..1360881)
Genome map
AA seq 269 aa AA seqDB search
MSRIADTFAALQEKGRKALIPYVTAGFPFADITPALMHGMVEAGADVIELGVPFSDPMAD
GPVIQKAGEKALSLGIGMPQVLEMVRSFRQRNQTTPVVLMGYANPVERYDQRHGKGAFAR
DAGAAGVDGVLVVDYPPEECEQFAADLRAHGIDLIFLLAPTSTPERMQQVARVASGYVYY
VSLKGVTGSGALDTAAVESMLPRIREHVKIPVGVGFGIRDAATAQAIGRVADAVVIGSRI
IQLIEDQPHEKVVGITVDFLRGIRKALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgctgacaccttcgccgccctgcaggaaaagggtcgcaaggcgctcatc
ccctacgtgacggcgggcttcccgttcgccgacatcacgcccgcgctcatgcacggcatg
gtggaggccggcgccgacgtgatcgagctcggcgtgcccttctccgaccccatggccgac
ggcccggtgatccagaaggcgggcgagaaggccctgtccctgggcatcggcatgccgcag
gtgctggagatggtgcgcagtttccgccagcgcaaccagaccacgcccgtggtgctcatg
ggctacgccaacccggtggagcgctacgaccagcgccacggcaagggcgcgttcgcccgc
gatgccggcgcggccggcgtggacggcgtgctcgtcgtggactacccgcccgaggaatgc
gagcagttcgccgccgacctgcgcgcacacggcatcgatctgatcttcctgctcgccccc
acctccacgcccgagcgcatgcagcaggtggcgcgcgtggccagcggctacgtgtactac
gtctcgctcaagggcgtgacgggctcgggcgcgctcgacaccgccgccgtcgagtccatg
ctgccgcgcatccgcgagcacgtgaagatccccgtcggcgtgggcttcggcatccgcgac
gcggccacggcccaggccatcggccgcgtggccgacgccgtggtcatcggcagccgcatc
atccagctcatcgaggaccagccgcacgagaaggtggtcggcatcaccgtggacttcctg
cgcggcatccgcaaggcgctcgacgcataa

DBGET integrated database retrieval system