KEGG   Alicycliphilus denitrificans K601: Alide2_1300Help
Entry
Alide2_1300       CDS       T01463                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00260  Glycine, serine and threonine metabolism
adk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01130  Biosynthesis of antibiotics
adk01230  Biosynthesis of amino acids
Module
adk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide2_1300
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alide2_1300
Enzymes [BR:adk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alide2_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEB83704
UniProt: F4GD21
Position
complement(1360878..1362146)
Genome map
AA seq 422 aa AA seqDB search
MFEYHQPDASGHFGPYGGSFASETLTHALTELREAYARYQHDPAFLAEFQYELAHFVGRP
SPVYHAARMSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRIIAETGAGQH
GVATATICARYGLQCVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVANVDDTFYIIGTVAGPHPYPVMVRDFQSVIGKECLEQMPAMLAEQKIAAEQPDAVVA
CVGGGSNAMGIFHPYIPFENTRLIGVEAAGEGLDSGKHSASLQRGSSGVLHGNRTYILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDKEALDAFHYLCRTEGIIPAL
ESSHAVAHAMKLAKTMTPQQSILVNLSGRGDKDIGTVADLSGADFYDRPSMRGHTVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaataccaccaacccgatgcatcgggccacttcggcccctatggcggcagcttc
gccagcgagaccctgacccatgcgctgaccgagctgcgagaggcctatgcgcgctaccag
cacgatccggcgttcctcgccgaattccagtacgagctggcccatttcgtgggccggccc
tcacccgtctaccacgccgcgcgcatgtcgcgcgagatgggcggcgcgcagatctacctc
aagcgcgaggacctcaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctcgcgcgccgcatgggcaagccgcgcatcatcgccgagaccggcgcgggccagcat
ggcgtggccacggccacgatctgcgcgcgctacggcctgcagtgcgtggtctacatgggc
gccgaggacgtcaagcgccagagccccaacgtctaccgcatgaagctgctgggcgccacc
gtggtgcccgtcgaatccggcagccgcacgctcaaggacgcgctcaacgaggccatgcgc
gactgggtggccaacgtggacgacaccttctacatcatcggcaccgtggccggcccgcac
ccctacccggtgatggtgcgcgacttccagagcgtgatcggcaaggaatgcctcgaacag
atgcccgccatgctggccgagcagaaaatagccgcagagcagcccgacgccgtggtcgcc
tgcgtgggcggcggcagcaacgccatgggcatcttccacccctacatcccgttcgagaac
acgcgcctgatcggcgtggaggccgcgggcgagggcctggacagcggcaagcactccgcc
agcctgcagcgcggcagcagcggcgtgctgcacggcaaccgcacctacatcctgcaggac
gagaacggccagatcaccgagacgcacagcatcagcgccggcctggactaccccggcgtg
ggccccgagcatgcctggctgcaggagatcggccgcgccgaatacgtgggcatcaccgac
aaggaggcgctcgacgccttccactacctgtgccgcaccgaaggcatcatcccggcgctc
gaatccagccacgccgtggcccatgcgatgaagctcgccaagaccatgacgccccagcaa
tccatcctcgtgaacctctccggccgcggcgacaaggacatcggcaccgtggccgacctg
tcgggcgcggacttctacgaccgccccagcatgcgcggccacaccgtcaagggagggccc
gccgcatga

DBGET integrated database retrieval system