KEGG   Alicycliphilus denitrificans K601: Alide2_1313Help
Entry
Alide2_1313       CDS       T01463                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00130  Ubiquinone and other terpenoid-quinone biosynthesis
adk00627  Aminobenzoate degradation
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Alide2_1313
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Alide2_1313
Enzymes [BR:adk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Alide2_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AEB83717
UniProt: F4GD34
Position
complement(1376669..1377253)
Genome map
AA seq 194 aa AA seqDB search
MSTPKRIIVGISGASGAVYGARLLQALQGMEGVESHLVVSHAGWLNLRHELDMERAEVEA
LADHVHDLADVGASIASGSFAAHGMVVAPCSMRTLAAIAHGLADNLLTRAADVVLKERRR
LVLLTRESPLHLVHLRNMATVTELGAICCPPMPAFYQRPTTIGEIVDHSVARALDLLGLD
NDLAPRWQGLPKNS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgaaacgcatcatcgtcggcatctccggcgccagcggcgccgtctatggc
gcgcgcctgctgcaggcgctgcagggcatggagggcgtggagtcgcacctggtcgtgtcg
cacgcgggctggctcaacctgcgccacgagctggacatggagcgcgccgaggtcgaggcc
ctcgccgaccacgtgcacgatctggccgacgtgggcgccagcatcgccagcggctccttc
gccgcgcacggcatggtggtggcgccctgctccatgcgcacgctggcggccatcgcccat
ggcctggccgacaacctgctgacccgcgccgccgacgtggtgctcaaggagcgccgccgc
ctggtgctgctcacgcgcgaatcgcccctgcacctggtgcacctgcgcaacatggccacc
gtgaccgagctgggtgcgatctgctgcccgcccatgcccgccttctaccagcgccccacc
accatcggcgagatcgtggaccacagcgtggcccgcgcgctggacctgctgggcctggac
aacgacctggcgccgcgctggcagggtttgcccaagaactcctga

DBGET integrated database retrieval system