KEGG   Alicycliphilus denitrificans K601: Alide2_1569
Entry
Alide2_1569       CDS       T01463                                 

Definition
(GenBank) CagE, TrbE, VirB component of type IV transporter system, conserved region
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:adk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Alide2_1569
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:adk02044]
    Alide2_1569
Enzymes [BR:adk01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Alide2_1569
Secretion system [BR:adk02044]
 Type IV secretion system
  Trb secretion system protein
   Alide2_1569
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG DUF853 AAA_10 AAA_22 TraG-D_C CbiA AAA_16 TrwB_AAD_bind FtsK_SpoIIIE NACHT ABC_tran RsgA_GTPase DUF87 Zot
Other DBs
NCBI-ProteinID: AEB83961
UniProt: F4GG91
Position
complement(1663023..1665476)
AA seq 817 aa
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRMGSGWALFIEAERRPAADYPHSEFPEPLSWVVEEERRAAFEESGNHFESGYH
LTLLYLPPEESRARAAKMLYENTPTNGVDWRERLQAFVAETDRVFDLLDGVMPEIDWLDD
AQTLTYLHATISTRRYRVGVPEVPFHIDALLTDSPLVGGLAPMLGDQHLRVVSVRGFPTS
TWPGILDDLNRLGFAYRWSTRFLCLDKAEAERELARLRRQWFAKRKNVIALLRETIFQQE
SPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDADAAVADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSLPGNAYANVRQPIVSTLNLAHMMPVSAVWAGQERNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRIFAFDMGR
SMRAAILGLGGEHYDLGTDGEIAFQPLARIDSEGYRTWAAEWIEGRLLHEGVAVGPDEKA
AIWSALGSLAGAPVEQRTMTGLSVLLQSNTLRQALSPYVLGGAHGKLLDADHDRLGMADV
QCFEMEELMHSKAAVMAVLHYLFARFDERFDGAPTLLILDEAWLFLDDPVFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQATEPQIRTIYEGFGLNRR
QIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDIGRVLLDAGVPGF
AGAWLRHRGLDWAADLLPSFPGLAPGSLADQPLENLS
NT seq 2454 nt   +upstreamnt  +downstreamnt
atgctgaacctcgccgaataccgccagcggccggccttgcttgccgactggctgccctgg
gccgggctggtcgcgccgggcgtcgtcttgaacaaggacggcagtttccagcgcacggcc
cggtttcgcgggcctgacctcgacagcgcgacgcaaggcgagctgatcgccacgtcggca
cggttgaacaacgcgctgcgccgcatgggatcgggctgggcgctgttcatcgaagccgag
cgtcggcctgcggccgattatccgcactcggagtttcccgagccgctttcctgggtggtg
gaggaagaacgccgggccgccttcgaggaatcgggcaatcacttcgagagcggctatcac
ctgacgctgctttacctgccgccggaagaatcccgcgcccgtgcagccaagatgctctac
gagaacacgccgacgaatggcgtggactggcgcgagcggctgcaagccttcgtcgcggaa
acggatcgcgtctttgacctgctcgacggcgtgatgccggagattgactggctcgatgac
gcgcagacgctgacctacctgcacgcgaccatctcgacgcggcgctatcgcgtcggcgtg
cccgaagtgccgttccacatcgacgcgctgctgaccgactcgccgctggtcggtggcctg
gcgcccatgctgggcgaccagcacctgcgcgtggtgtcggtgcggggcttcccgacctcg
acctggccggggattctggacgacctcaaccgcctgggctttgcgtaccgctggagcacg
cgctttctctgcctcgacaaagccgaggcggaaagagaactcgcccgcctgcgccgccag
tggttcgccaagcgcaagaacgtcatcgcgctgctacgcgaaacgatcttccagcaggaa
agcccgctggtcgataccgacgccaacaacaaggccgccgacgccgatgctgccttgcag
gagctgggcagcgatcaagtcgccttcggctacctgacggcgaccgtcaccgtcatggac
gcggacgccgccgtggccgacgagaagctgcgcatggtggagcgcgtcatacagggtcgg
ggcttcgtcaccatccccgaaacgctcaacgccgtggatgcgtggctgtcctcgctcccc
ggcaatgcttacgccaacgtgcgccagcccatcgtctcgacgctgaatctggcgcacatg
atgccggtgtcggcggtatgggccggccaggagcgcaacgatcatttggacggcccaccg
ttgatcgtgacacgtaccgatggcgctacgccgttccggctggtgacgcacatcggcgac
gtgggccacacgctggtcgcaggcccgaccggcatgggcaagtcggtcttgctcgccacg
ctggcgatgcagttccgccgctatcgcggctcgcgcatcttcgccttcgacatgggccgt
tccatgcgggccgccatcctcggcctgggcggcgagcactacgacctgggcacggatggc
gaaatcgccttccagccgctcgcgcgcatcgacagtgagggctaccgcacctgggccgcc
gaatggatcgaaggccgcttgctgcacgaaggcgtggcagtcggccccgacgagaaggcg
gctatctggtcggcgctgggaagtctcgccggtgcgccggtggagcagcgcacgatgacg
ggactttccgtgctgctgcaatcgaacacgctgcggcaggcgctttcgccctatgtgctg
ggtggcgcccacggcaagctgctggacgccgaccacgaccggctgggcatggccgacgtg
cagtgcttcgagatggaggaactgatgcacagcaaggccgccgtcatggccgtgctgcat
tacctctttgcgcgtttcgatgaacgcttcgacggggcgcccacgctgctgatcctcgat
gaagcgtggctgttcctcgatgacccggtgttcgcggcgcgcatccggcagtggctcaag
acgctcaggaaaaagaacgtcagcgtcatcttcgccactcagagccttgccgacatcaag
gattcgagcatcgcgcccgcgatcatcgagagctgtgcgagtcggattttcttgcccaac
ccgcaggcgacagagccgcagattcgcacgatctacgagggcttcggcctcaacaggcgg
cagatcgaaatcgtcgccaccgcgcagcccaagcgtgactactactaccaatcccgcctc
ggcaaccgcctgttcgacctcgacctggggccggcggccctggccttcgcgggcgcgtcc
acgccgcaagaccagcgcgacataggccgcgtgctgctggacgccggcgtgcccggcttc
gcgggcgcttggctgcgccatcgcggcctcgattgggcggccgacctgctgccctcgttc
cccggcctcgcgccgggttccctcgctgaccaacccctggagaacctgtcatga

DBGET integrated database retrieval system