KEGG   Alicycliphilus denitrificans K601: Alide2_1783Help
Entry
Alide2_1783       CDS       T01463                                 

Definition
(GenBank) conjugative coupling factor TraD, SXT/TOL subfamily
Organism
adk  Alicycliphilus denitrificans K601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 AAA_16
Motif
Other DBs
NCBI-ProteinID: AEB84169
UniProt: F4G5J3
Position
1877261..1879417
Genome map
AA seq 718 aa AA seqDB search
MAQPHAVEVLLRPAVELHTVAVCTGAAILCLVAPWSLALNPLLGLGSALAFLTFGAIRLR
DAWAILRYRRNIRRLPRYVMTSRDVPVSQQRLFVGRGFRWEQRHTHRLMQTYRPEFRRYV
EPTAIYRAARRLEERLEFAPFPVSTLARALAWDSPLNPARPLPPVGGMPRLHGIEPHEVD
VTLPLGERVGHTLVLGTTRVGKTRLAELFITQDIRRKVRGEHEVVIVFDPKGDADLLKRM
YVEAKRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREFA
WRFVNIIARALVELGQRPDYLLIQRHVINIDALFIEYAQHYFAKNEPKAWEVIVQLEGKL
NDKNIPRNMIGREKRVVALEQYLSQVRIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEK
LTTGKIAQLLAPNYSDLSDPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDL
VSVAGHIYKFGIDDGLPGAAVGAKIPINVHADEFNELMGDEFIPMVNKGGGAGVQVTAYT
QTLSDIEARIGNRAKAGQVVGNFNNLFMLRVRETATAELLTRQLPQVEVYATALMSGATD
SSDPHGNTAFTSNTQDRISSNSVPLIEPAHVVALPKGQCFALTEGGNLWKVRMPLPAPDP
DEAMPKDLQELAGYMRQHYVEAGDWWENQGIPGLQDKALPDDLLDDFKQMAAAEEAEA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcccagccgcatgcggtcgaggttctgctgcggccagcggtggagcttcataccgtg
gcggtctgcaccggcgccgcgattctgtgcctggtggcaccgtggtcgctcgcgctgaac
ccgctgctcggcctgggctcggcactggccttcctgaccttcggcgcgattcgcctgcgc
gatgcctgggcgatcctgcgctatcgccgcaacatccgccgcctgccgcgctacgtgatg
accagccgcgacgtgccggtgagtcagcaacggctgttcgtcggccggggctttcgctgg
gagcagcggcacacgcaccggctgatgcagacctaccggccggagttccgccgctatgtc
gagccgacggcgatctaccgggccgcccggcggctggaggagcggcttgagttcgcgccg
tttcccgtctcgacgctggcgcgcgcgctggcctgggacagcccgctcaacccagcgcgg
ccgctgccgccggtcggcggaatgccgcgcctgcatggcatcgagccgcacgaggtcgac
gtcaccctgccgctgggcgagcgcgtcggccacaccctggtgctgggcaccacgcgcgtg
ggcaagacgcggctggccgagttgttcatcacgcaagacatccgccgcaaggtccgcggc
gagcacgaggtggtgatcgtcttcgaccccaagggcgatgccgacctgttgaagcgcatg
tacgtcgaggccaagcgcgccgggcgcgaaggcgagttctacgtcttccacctgggctgg
ccggacatctcggcgcgctacaacgccgtcggccggttcgggcggatctccgaggtggcc
acgcgcatcgccggacagctctcgggcgaaggcaacagcgccgccttccgcgaattcgcc
tggcgcttcgtcaacatcatcgcacgcgccctggtcgaactggggcagcggccggactac
ctgctgatccagcgccacgtcatcaacatcgacgcgctgttcatcgagtacgcccagcac
tacttcgccaagaacgagccgaaggcctgggaggtcatcgtccagctcgaaggcaagctg
aacgacaagaacatcccgcgcaacatgatcgggcgtgagaagcgcgtggtggccctcgaa
cagtacctgtcccaagtgcgcatctatgacccagtgctcgacggcctgcgcagcgccgtg
cgctacgaccggacgtacttcgacaagatcgtcgcttcgctgctgccgctgctggagaag
ctcaccacgggcaagatcgcccaactgctcgcaccgaactattccgacctgtccgacccg
cggccgatcttcgactggatgcaggtcatccgcaaacgcgcggtggtctacgtggggctg
gatgcgctgtccgacgccgaagtcgcggcggcggtgggcaactcgatgttcagcgacctg
gtctcggtcgccggccacatctacaagttcggcatcgacgacgggctgcccggcgcagcg
gtgggcgccaagattcccatcaacgtccacgccgacgaattcaatgaactcatgggcgac
gagttcatcccgatggtcaacaagggcggcggtgccggcgtgcaggtgacggcctacacg
cagaccttgagcgacatcgaggcccgcatcggcaatcgtgccaaggccggccaggtggtc
ggcaacttcaacaacctgttcatgctgcgcgtgcgcgagaccgccaccgccgagctgctg
acgcgacaactgccccaggtcgaggtgtacgccacggcgctgatgagcggcgccaccgac
agctccgatccgcacggcaataccgcgttcacgtccaacacccaggaccgcatcagcagc
aacagcgtgccgttgatcgagccggcgcatgtggtggcgctgcccaaggggcagtgcttc
gcgctgaccgagggcggcaacctctggaaagtccgcatgccgctgcctgcgcccgacccc
gacgaagccatgccgaaggatctgcaggagctggccggctacatgcgacagcactacgtc
gaggcaggagactggtgggagaaccaaggcatccccggcctgcaggacaaggcgctgccc
gacgacctgctggacgacttcaagcagatggccgcggctgaagaggccgaagcatga

DBGET integrated database retrieval system