KEGG   Alicycliphilus denitrificans K601: Alide2_1809Help
Entry
Alide2_1809       CDS       T01463                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4711 family
Organism
adk  Alicycliphilus denitrificans K601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Snapin_Pallidin DivIC
Motif
Other DBs
NCBI-ProteinID: AEB84195
UniProt: F4G5L9
Position
1911038..1912444
Genome map
AA seq 468 aa AA seqDB search
MNASLPDFLHRAKSPLRATLLVAAITLVVGVAWAQTRIDPNGVNVSGSVIGDDVLYSIGG
GRAVSMGGAGNMQSIGVGVGWNSNLICGDMSITTTLQNQLNGITNGFQTIMSNVIQNATA
AVASLPALIIQRADPGLYNLLTNGILQARLDFDRSKMTCRAIANRMADMAGGQAGWDQLA
EGMALRDAVSSTDAVSAIEQAESNKGNNGVPWVGGGNAGGSGQSSIKVVGDVTRAGYNLL
NGRSATDTSSIARSACGNRLTCQTWSSPGAAAAFANRVLGEREQRTCENCTKTQTTPGVG
LTPVIQEEYETKLQVLQELVTGARPTTLANLDAAGSSSLPITRGVIEALRDEPDQDVLGR
RLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVDQENSALEQEINNLKTELE
LRRTLAGNSAMAIIQRHSTRAAGSRGVFEGDTTRDRLREVQKPRSGTP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcctccctccctgacttcctgcaccgcgcgaagtcgcccctgcgggccacgctg
ctcgtggcggccatcacgctggtcgtcggcgtcgcctgggcgcagacccgcatcgacccc
aatggcgtgaacgtcagtggcagcgtgatcggcgacgacgtgctctacagcatcggcggc
ggccgggccgtgtcgatgggtggtgccggcaacatgcagagcatcggcgtcggcgtcggc
tggaacagcaacctgatctgcggcgacatgagcatcaccacgacgctgcagaaccagctc
aacggcatcaccaacggcttccagacgatcatgagcaacgtgatccagaacgccactgcc
gcggtggcgtcactcccggcgctcatcatccagcgcgccgacccgggcctgtacaacctg
ctcaccaacggcatcctccaggcgcgcctggatttcgaccgctcgaagatgacctgccgg
gccatcgccaatcgcatggcggacatggccggcggccaggccggctgggaccagctcgcc
gaagggatggcgctgcgggatgcggtcagcagcaccgatgccgtctccgccatcgagcag
gccgagtccaacaaggggaacaacggcgtgccctgggtcggcggcggcaacgcgggcggc
tccggccagagttcgatcaaggtggtcggcgacgtgacgcgcgcgggctacaacctgctc
aacgggcgcagcgccaccgatacctcgtcgatcgcgcgcagcgcctgcggcaaccgcctg
acctgccagacctggtcgtcgcctggcgcggccgcggcctttgcgaaccgcgtgctgggc
gaacgcgagcaacgcacctgcgaaaactgcacgaagacccagaccacgcctggcgtcggg
ctcacgccagtgatccaggaagagtacgagaccaagctgcaggtgttgcaggaactggtg
acgggcgcccggccgacgacactggccaatctcgacgcggccggcagcagctcgctgccg
atcacccgcggcgtgatcgaggccctgcgtgacgagcccgaccaggacgtgctgggccgg
cgtctcgcgtccgaggctgcgctgtccagcgtgctggagaaggccctgctgctgcaacgc
acgttgctgaccggcaagaaggagccgaacgtcgccgccaacgagctcgccgtgcaggcg
gtggaccaggagaacagcgcgctggagcaggagatcaacaacctcaagaccgagctggag
ctgcgccgcacgctggccggcaactcggcgatggcgatcatccagcgccacagtacccgc
gctgccggctcgcgcggcgtcttcgagggcgacaccacgcgcgaccgtctgcgggaagtc
cagaagccgcggagcggtacgccatga

DBGET integrated database retrieval system