KEGG   Alicycliphilus denitrificans K601: Alide2_1908
Entry
Alide2_1908       CDS       T01463                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4693 family
Organism
adk  Alicycliphilus denitrificans K601
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-ProteinID: AEB84286
UniProt: F4G6H7
Position
2010699..2011430
AA seq 243 aa
MKHAAIYLAAILAAVVGTAGTASAQSAPVASSRTVPAQVHNSTDAALDERLARDWGLRPE
EWARYRQLMQGPLGIYSPNLDPLTALGIEARSDEERSRYAELQVQAESKRVGKTLAYQRA
YDAAWKRLYPGQQRVNMPGAKAPGAGNRGSGRLAVFVKAECPPCEQRVRQLQAAGTAFDL
YMVGSRQEDARIRQWATQAGIDAGRVRSRTITLNHDAGRWLSLGLPGDLPAVVREVNGQW
QRQ
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaagcacgccgcgatctacctcgccgccatcctcgccgctgtcgtaggcaccgcaggc
acggcctcggcgcagtcggcgccggtcgcgtcctcgcgcaccgttcccgcccaggtgcac
aacagcaccgacgccgcactggacgaacggctggcgcgcgattggggcctgcgccccgag
gagtgggcgcgctaccggcaactgatgcaggggccgctgggcatctattccccgaacctc
gatccgctcacggcgctgggcatcgaggcgcgcagcgacgaggaacgcagccgctatgcg
gagctgcaggtgcaggcggaatcgaagcgcgtgggcaagacgctggcctaccagcgggcc
tacgacgcggcctggaagcggctgtatccgggacagcagcgcgtgaacatgccgggtgcg
aaggcaccgggcgctggcaaccggggctcgggccggctggcggttttcgtgaaagccgag
tgccccccgtgcgagcagcgcgtgcgccagttacaagcggccggcaccgccttcgacctc
tacatggtcggcagccgccaggaggacgcccgcatccgccaatgggcgacgcaggccggc
atcgacgccggccgcgtgcgctcgcgcaccatcacgctcaaccatgacgccgggcgctgg
ctgtcgctcggcctgcccggcgacctgcccgccgtggtgcgcgaggtcaacggccaatgg
cagcggcaataa

DBGET integrated database retrieval system