KEGG   Alicycliphilus denitrificans K601: Alide2_1911
Entry
Alide2_1911       CDS       T01463                                 
Name
(GenBank) conjugative coupling factor TraD, SXT/TOL subfamily
Organism
adk  Alicycliphilus denitrificans K601
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 Cpta_toxin
Other DBs
NCBI-ProteinID: AEB84289
UniProt: F4G6I0
Position
2012598..2014757
AA seq 719 aa
MAQSQAVEVLLRPAVELYTVAVCAGAAFLCLVAPWSLALSPLLGLGSALAFLTFGALRLH
DAWAILRYRRNIRRLPRYVMTSRDVPVSQQRLFVGRGFRWDQRHTHRLMQTYRPEFRRYV
EPTAIYRAARRMEERLEFAPYPLSKMAKALAWDSPLNPARPLPPVGGLPRLHGIEPHEVD
VTLPLAERVGHSLVLGTTRVGKTRLAELFITQDIRRKVNGQHEVVIVFDPKGDADLLKRM
YVEAKRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREFA
WRFVNIIARALVELGQRPDYLLIQRHVINIDALFIEYAQHYFAKNEPKAWEVIVQLEAKL
NDKNIPRNMIGREKRVVALEQYLSQVRIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEK
LTTGKIAQLLAPNYSDLADPRPIFDWMQIIRKRAVVYVGLDALSDAEVAAAVGNSMFSDL
VSVAGHIYKFGIDDGLPDAATGIKVPINVHADEFNELMGDEFIPMVNKGGGAAVQVTAYT
QTLSDIEARIGNRAKAGQVVGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTVMSGATD
SSDPTGNTAFTSNTQDRISSNSVPLIEPAHVVGLPKGQCFALIEGGHLWKVRMPLPALDP
DEAMPKDLQELAGYMRQHYVEAGEWWDNKGLPGLQDQALPDDLLADFKQMAGADEEATA
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggcccagtcccaagccgtcgaagtcttgctgcggccagcggtggagctatacaccgtc
gcggtctgtgcgggcgccgcgtttctgtgcctggtggccccgtggtcgctcgcgctgagc
cccttgctgggcctgggcagcgcgctagccttcctgaccttcggtgcgctgcgcttgcac
gacgcctgggccatcctgcgctaccggcgcaacatccggcgcctgccgcgctatgtgatg
accagccgcgacgtgccggtcagccagcagcggctcttcgtcggccggggcttccgctgg
gaccagcggcacacgcaccggctgatgcagacctaccggccggagttccgccgctacgtc
gagccgacggcgatctaccgggcagcgcggcgcatggaagagcgcctggagttcgcgccg
tacccgctgtccaagatggcgaaggccctggcctgggacagtccgctcaacccggcacgg
ccgctgccgccggtgggaggcctgccgcggctgcacggcatcgagccgcacgaggtcgac
gtcacgctgccgttggccgaacgggtcggccattcgttggtgctcggcacgacgcgtgtc
ggcaagacccgcctggccgagttgttcatcacgcaggacatccggcgcaaggtcaatggg
cagcacgaggtcgtaatcgtcttcgaccccaagggcgatgcggacctcttgaagcgcatg
tatgtggaggccaagcgcgccgggcgcgaaggcgagttctacgtcttccacctgggctgg
ccggacatctcggcgcgctacaacgcggtgggccgcttcgggcgcatcagcgaagtcgcc
acgcgcatcgctggccagctctccggtgaaggcaacagcgcggctttccgcgagtttgcc
tggcgcttcgtcaacatcatcgcgcgtgccctggtggagctggggcagcggcccgattac
ctgctgatccagcgccacgtcatcaacatcgatgcgctgttcatcgagtacgcgcagcac
tacttcgccaagaacgagccgaaggcctgggaggtcatcgtccagctcgaagccaagctg
aacgacaagaacatcccgcgcaacatgatcggccgcgaaaagcgcgtcgtcgcgctggag
cagtacctgtcgcaggtgcgcatctacgacccggtgctcgacggcctgcgcagcgcggtg
cgctacgacaggacgtacttcgacaagatcgtcgcatcgctgctgccgctgctggagaag
ctgaccaccggcaagatcgcgcagttgctggcgccgaactattcggacctcgccgaccca
cgcccgatcttcgactggatgcagatcatcaggaagcgggccgtggtctacgtcgggctc
gatgcgctgtcggacgcggaagtcgcggcggcggtcggcaactcgatgttctccgacctc
gtatccgtcgcgggtcacatctacaagttcggcatcgacgacggcctgccggatgccgcg
acgggcatcaaggtgcccatcaacgtccatgccgacgagttcaacgaactcatgggcgat
gagttcatcccgatggtcaacaagggcggcggcgcagccgtccaggtcacggcctacacg
cagaccctctcggacatcgaggcccgcatcggcaaccgcgcgaaggcgggccaggtcgtg
ggcaacttcaacaacctgttcatgctgcgcgtgcgcgagaccgccacggccgaactgctg
acgcgccaactgcccaaggtcgaggtctacacgacgacagtgatgagcggcgccaccgac
agctccgacccgaccggcaacaccgccttcacgtcgaacacgcaggaccgcatcagcagc
aacagcgtgccgctgatcgagccggcgcacgtggtgggcctgcccaaaggccaatgcttc
gcgctgatcgagggcgggcacctgtggaaggtgcgcatgccgttgccggcactggacccc
gacgaggccatgcccaaggatctgcaggagctggccggctacatgcggcagcactacgtc
gaggccggcgagtggtgggacaacaaggggcttcccggcctgcaggaccaggcgctgccc
gacgatctgctggccgacttcaagcagatggcgggcgcggatgaagaggccacggcatga

DBGET integrated database retrieval system