KEGG   Alicycliphilus denitrificans K601: Alide2_1916
Entry
Alide2_1916       CDS       T01463                                 

Definition
(GenBank) conjugative transfer region protein, TIGR03750 family
Organism
adk  Alicycliphilus denitrificans K601
SSDB
Motif
Pfam: DUF3487
Other DBs
NCBI-ProteinID: AEB84294
UniProt: F4G750
Position
2016672..2017100
AA seq 142 aa
MAGALESPSRDGLVTFLPHRLNRHPVVVRGLTADELWVCAGLSGAAGLVAGVPLAWLTHS
IAMVPTLIVAGIGVGVFVGGGLLRRWKRGRPDTWLYRQLQWRLALRYPALAAHAGRGQLI
TRSGWWSTRRLRPDPSLRRGRP
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccggcgccctggagagtccgtcgcgcgacgggctcgtgaccttcctgccgcaccgc
ctcaaccgccacccggtggtcgtgcgcgggctcacggccgacgagctgtgggtctgcgcc
gggctgtccggcgcggccggtctcgtggccggcgtgccgctggcctggctgacgcacagc
atcgcgatggtgcccacgctgatcgtcgccggcatcggtgtcggtgtcttcgtgggcggc
ggcctgctgcggcggtggaagcgcggccggcccgacacctggctgtaccgccagctccag
tggcgcctcgcgctgcgctaccccgcgctggctgcgcatgcgggccggggccagctcatc
acccggtcgggctggtggtccacgcggcgcctgcggcccgatccgtccctgcgtcgaggt
agaccatga

DBGET integrated database retrieval system