KEGG   Alicycliphilus denitrificans K601: Alide2_1958
Entry
Alide2_1958       CDS       T01463                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4711 family
Organism
adk  Alicycliphilus denitrificans K601
SSDB
Motif
Pfam: DivIC
Other DBs
NCBI-ProteinID: AEB84333
UniProt: F4G789
Position
2056807..2058207
AA seq 466 aa
MKTSISRCAQRAKPYTLSVALACAVTAGAGVAWAQTRINPTGVGVSGSVIGDDVLYSIGG
GRAVSMGGAGNMQSIGVGIGWNSNLICGDMSITTTLQNQLNGITNGFQQIMSNVIQSATS
AVASLPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCKAMANRMADMAGGQAGWDQLA
EGFALRDAVSSTDAVSAVEQAESNKGNNGVPWVGGGNAGGSGQGSIKVVGDVTRAGYNLL
NSRGVTDTSSIPRASCGNRLTCQTWSSPQAAADFATRVLGEREQRTCETCTKTQTTPGVG
LTPVIQEEYETKLQALQGLVTGSTPMTVANLETAGSNSLPITRGVIEALRDEPDQDLLGK
RLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVKAVDQENTALEQEINNLKTELE
LRRTLAGNSAMAIVQRHGTRAAGSRGIFEGDTTRDRLKEVQKPRNN
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaaaacgtctatctcccgttgcgcgcaacgcgccaagccctacacgctcagcgtcgcg
ctcgcctgcgccgtcaccgccggggccggcgtcgcgtgggcgcagacccgcatcaacccg
accggcgtcggcgtgagcggcagcgtgatcggcgacgacgtgctctacagcatcggcggc
ggccgcgccgtgtccatgggtggcgccgggaacatgcagagcatcggtgtgggcatcggc
tggaacagcaatctcatctgcggcgacatgagcatcacgacgacgctgcagaaccaattg
aacggcatcaccaacggcttccagcagatcatgagcaacgtgatccagagcgcgaccagc
gcggtcgcctcgctgccagcgctgatcatccagcgcgccgatccgggcctctacaacctg
ctgaccaacggcgtgctgcaggcccggctcgacttcgaccgcagcaagctgacgtgcaag
gcgatggccaaccggatggcggacatggccggcggccaagccggatgggatcagctcgcc
gaaggcttcgcgctgcgcgatgcggtgagcagcaccgatgcggtgtccgccgtcgagcag
gccgaatccaacaagggcaacaacggcgtgccctgggtcggaggcggcaacgcgggcggt
tcgggccagggctcgatcaaggtggtcggcgacgtgacccgcgccggctacaacctgctc
aacagccgcggcgtcacggacacctcgtccatcccgcgcgcatcctgcggcaaccggctg
acctgccaaacctggtcctcgccgcaggccgccgcggacttcgcgacccgcgtccttggt
gagcgcgagcaacgcacctgcgagacctgcaccaagacgcagacgacgcccggtgtcggc
ctgacgccggtgatccaggaagagtacgagaccaagctgcaggcgctgcagggactcgtg
accggctcgacgccgatgacggtagcgaacctcgaaaccgccggcagcaactccctgccg
atcacgcgcggcgtgatcgaggcgctgcgcgacgaacccgatcaagacctgctcggcaag
cgcctggcgtccgaggccgcgctgtcgagcgtgctggagaaggccttgctgttgcagcgc
acgctgctgaccggcaagaaggagcccaacgtcgccgccaacgagctggccgtgaaggcg
gtcgatcaggagaacactgcgctggagcaggagatcaacaacctcaagaccgagctggag
ctgcggcgcacgctggccggcaattcggcgatggcgatcgtgcagcggcacggcacccgc
gccgccggctcgcgcggcatcttcgagggcgacaccacgcgcgaccggctcaaggaagtg
cagaagccgaggaacaactga

DBGET integrated database retrieval system