KEGG   Alicycliphilus denitrificans K601: Alide2_2456Help
Entry
Alide2_2456       CDS       T01463                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00071  Fatty acid degradation
adk00072  Synthesis and degradation of ketone bodies
adk00280  Valine, leucine and isoleucine degradation
adk00310  Lysine degradation
adk00362  Benzoate degradation
adk00380  Tryptophan metabolism
adk00620  Pyruvate metabolism
adk00630  Glyoxylate and dicarboxylate metabolism
adk00640  Propanoate metabolism
adk00650  Butanoate metabolism
adk00900  Terpenoid backbone biosynthesis
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
adk01212  Fatty acid metabolism
adk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alide2_2456
   00630 Glyoxylate and dicarboxylate metabolism
    Alide2_2456
   00640 Propanoate metabolism
    Alide2_2456
   00650 Butanoate metabolism
    Alide2_2456
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Alide2_2456
   00072 Synthesis and degradation of ketone bodies
    Alide2_2456
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Alide2_2456
   00310 Lysine degradation
    Alide2_2456
   00380 Tryptophan metabolism
    Alide2_2456
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Alide2_2456
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Alide2_2456
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Alide2_2456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adk04147]
    Alide2_2456
Enzymes [BR:adk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Alide2_2456
Exosome [BR:adk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Alide2_2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEB84815
UniProt: F4GD56
Position
2560955..2562133
Genome map
AA seq 392 aa AA seqDB search
MEDIVIVSAVRTPVGKFGGALAKTPATDLGALVIREALARARVAPDQVGEVIMGQVLAAG
CGQNPARQAMMKAGVAKETPALTINAVCGSGLKAVMLAAQAVATGDSEIVVAGGQENMSL
APHVLNGSREGQRMGDWKLTDTMIVDGLWDVYNQYHMGITAENVAKAYGITREMQDALAL
ASQQKAAAAQDAGRFADEIVGVSLPQKKGDPVLFNADEYLNRKTNAEALAGLRPAFDKAG
SVTAGNASGINDGAAAVVVMSAKKAAALGLKPLARIAAYGTAGLDPATMGMGPVPASRKA
LQRAGWNAADVDLFELNEAFAAQACAVNKELAIDPARVNVNGGAIAIGHPIGASGCRVLV
TLLHEMQRRSAAKGLAALCIGGGMGVSMALER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcgtcatcgtttccgccgtgcgcacgcccgtgggcaagtttggcggcgca
ctcgccaagaccccggccacggacctgggcgcccttgtgatccgcgaggccctggcgcgc
gcgcgcgtcgcgccggaccaggtgggcgaggtcatcatgggccaggtgctcgcagccggc
tgtggccagaaccccgcgcgccaggccatgatgaaggccggcgtggccaaggaaaccccc
gcgctcacgatcaacgccgtgtgcggctcgggcctgaaggctgtcatgctcgccgcgcag
gccgtcgccacgggcgacagcgagatcgtggtggccggcggccaggagaacatgagcctg
gcgccccacgtgctcaatggctcgcgcgagggccagcgcatgggcgactggaagctgacc
gacaccatgatcgtggacggcctgtgggacgtctacaaccagtaccacatgggcatcacg
gccgagaacgtggccaaggcctacgggatcacgcgcgagatgcaggacgcgctggccctg
gccagccagcagaaggccgcggccgcccaggatgccggccgcttcgccgacgagatcgtc
ggcgtctcgctgccgcagaaaaagggcgatcccgtcctgttcaacgccgacgagtacctg
aaccgcaagaccaacgccgaggcgctggcgggcctgcgcccggcattcgacaaggccggc
tcggtcacggcgggcaacgcctcgggcatcaacgacggcgccgctgccgtggtggtgatg
agcgccaagaaggccgcggccctgggcctcaagccgctggcgcgcatcgccgcctacggc
acggcgggcctggaccccgccaccatgggcatggggcccgtgcccgcgtcgcgcaaggcc
ctgcagcgcgccggctggaacgcggccgacgtggacctgttcgagctcaacgaggccttt
gccgcccaggcatgcgcggtgaacaaggaactggcgatcgacccggcgcgcgtcaacgtc
aacggcggcgcgatcgccatcggccaccccatcggggcctcgggttgccgcgtgctggtc
accctgctgcacgagatgcagcgccgcagcgcggccaaggggctggccgcgctgtgcatc
ggcggcggcatgggcgtctccatggctctggagcgttga

DBGET integrated database retrieval system