KEGG   Alicycliphilus denitrificans K601: Alide2_2741
Entry
Alide2_2741       CDS       T01463                                 

Definition
(GenBank) outer membrane efflux protein
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
adk  Alicycliphilus denitrificans K601
Brite
KEGG Orthology (KO) [BR:adk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adk02000]
    Alide2_2741
Transporters [BR:adk02000]
 Other transporters
  Pores ion channels [TC:1]
   Alide2_2741
SSDB
Motif
Pfam: OEP DUF1811
Other DBs
NCBI-ProteinID: AEB85093
UniProt: F4GGD9
Position
complement(2873637..2874911)
AA seq 424 aa
MMPMRNRLSLGVVVVSLALSSMVHAQEAKLGSSVEGLLQAARDRNPEIASMRFDADAAAE
RVAPAGALPDPKIRTELRDITRMGEQNPTLLPGRVGSTRYVLMQDFPWMGKRGLKREVAE
SQAQAARSRAAGAWVELAAKIKTTYAELYYLDQNERLSREILDLMARLEKVAQVRYAGGL
AAQQDVIRAQVEQSTMRNELIALDAERRQLQSKLNALVGRPTSEILAAPEQIRALPSPEQ
VSFAALEGRARMNNPLLRTEESQIRAAEKNRELTYKNRYPDFNVGISPIQYRGSIKEWEL
MVELNIPLQQDSRRAQERESEAMLAAARSRQEVVTNQVLADLYANVAGFESARRSLALTT
ESLLPQSELTFRSALAGYQTGKVDFATLLDAQRQIRQSKLNQIKAGVEAQKRLTEIERIV
GEEQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgatgcctatgaggaatcgtctgtcgttgggggtagtcgtggtgtctctggcgctgagc
tcgatggttcacgcgcaggaggccaagctgggatcgagtgtcgaagggttgctgcaagcg
gccagggatagaaacccagaaatcgccagcatgcgttttgatgcggatgcggcagcagag
cgcgtcgcgcctgcgggcgccttgccggatccgaaaattcgaaccgaattgcgtgacatc
acgcgcatgggagaacaaaaccccacgctattgccagggcgcgtcggaagcacccgctac
gtgctgatgcaggattttccctggatgggcaaacgcggtctgaagcgtgaggtggctgag
tcacaagcacaagctgcgagaagccgtgcagcaggcgcctgggttgaactggctgccaag
atcaagacgacttatgccgagctctattatctggaccagaacgaacgcttgtcgcgggaa
attctcgacctgatggcgcgattggaaaaagtcgcgcaggtccgctatgcgggcgggctt
gctgcgcaacaggatgtgatccgtgcgcaggtggagcagtccaccatgcgcaacgaactg
attgcactggacgctgagcgtcgccaactccagtccaagttgaatgcgctcgtggggcgt
ccgacctcggagattttggctgcacccgagcagatccgcgccttgccgtcgccggagcaa
gtcagcttcgcagcgctggaagggcgcgcccggatgaacaatccgctgctgcgcacggaa
gagtcccagatcagggcggccgagaagaaccgcgagctgacctacaagaaccgctatccc
gacttcaacgtcggtatctctccgattcagtaccgaggctcgatcaaagagtgggagctg
atggtcgagttgaatattcccctgcagcaagattcgcggcgcgcccaggagcgggagtcc
gaggccatgttggccgctgcacgctcacgccaggaagtcgtcacgaatcaagtcctggca
gacctttacgccaacgtggcaggttttgagtccgcccggcgctctctggcgttaacgacc
gaaagtctcttgccgcagtcggagttgaccttccgctctgcgctggctgggtaccagacg
ggcaaggtggattttgcgaccttgctggacgcgcagcgccagattcgtcagtccaaactg
aatcagatcaaagccggcgtggaagcgcagaagcggcttaccgaaattgaacgcatcgtg
ggagaagaacaatga

DBGET integrated database retrieval system