KEGG   Alicycliphilus denitrificans K601: Alide2_4008Help
Entry
Alide2_4008       CDS       T01463                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00010  Glycolysis / Gluconeogenesis
adk00051  Fructose and mannose metabolism
adk00562  Inositol phosphate metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
adk01230  Biosynthesis of amino acids
Module
adk_M00002  Glycolysis, core module involving three-carbon compounds
adk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_4008
   00051 Fructose and mannose metabolism
    Alide2_4008
   00562 Inositol phosphate metabolism
    Alide2_4008
Enzymes [BR:adk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Alide2_4008
Exosome [BR:adk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Alide2_4008
  Exosomal proteins of bladder cancer cells
   Alide2_4008
  Exosomal proteins of melanoma cells
   Alide2_4008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB86327
UniProt: F4G4B1
Position
4176303..4177106
Genome map
AA seq 267 aa AA seqDB search
MDDMTQKKKLIAGNWKMNGSLQANAALLQALRDGLGEAACAVAVAVPAPYLAQVQGLVAG
SAIALAAQDVSQHESGAFTGEVSAAMLRDFGTRYVLVGHSERRQYHGETDAVVAAKAQRA
LAAGITPIVCVGETLAEREAGQTEAVVKRQLAAVVQSNGQCISEIVVAYEPVWAIGTGRT
ATPEQAQQVHAVLRAQLAAATERADRVSLLYGGSMNAANAAQLLAQPDIDGGLVGGASLK
AADFLQIIAAAHAIQAQAATELGAEKA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatgactcagaaaaagaaactcattgccggcaactggaagatgaacggcagc
ctgcaggccaacgcggccctgctgcaggcgctgcgcgacgggctcggcgaggccgcctgc
gccgtggccgtggccgtcccggcgccgtacctggcgcaggtgcaggggctggtcgccggc
tcggcgatcgcgcttgccgcccaggacgtgtcgcagcatgagtcgggcgcgttcacggga
gaggtctccgcggccatgctgcgcgacttcggcacgcgctacgtgctcgtggggcactcc
gaacgccgccagtaccacggcgagacagatgccgtggtggcggccaaggcgcagcgcgcg
ctggcggctggcatcacgcccatcgtgtgcgtgggcgagactctggcggagcgcgaggcg
gggcagacggaggccgtggtcaagcgtcagctggcggcggtggtgcagtccaatggccag
tgcatcagcgaaatcgtggtcgcctacgagcccgtctgggccatcggcacgggccgcacg
gcgacccccgagcaggcccagcaggtgcacgccgtgctgcgcgcccagctggcggcggcg
accgagcgcgccgaccgcgtgtccctgctgtacggtggcagcatgaatgccgccaacgcg
gcgcagctgctggcgcagcccgacatcgacggcggcctggtgggcggggcctcgctcaag
gccgcagattttctgcaaattattgctgcagcgcatgctatacaagcgcaagcagctacg
gaattaggagctgaaaaagcatga

DBGET integrated database retrieval system