KEGG   Alicycliphilus denitrificans K601: Alide2_4606Help
Entry
Alide2_4606       CDS       T01463                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00020  Citrate cycle (TCA cycle)
adk00640  Propanoate metabolism
adk00660  C5-Branched dibasic acid metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
Module
adk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide2_4606
   00640 Propanoate metabolism
    Alide2_4606
   00660 C5-Branched dibasic acid metabolism
    Alide2_4606
Enzymes [BR:adk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Alide2_4606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEB86908
UniProt: F4GAX0
Position
complement(4838580..4839740)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRSFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKTIDDVKTLASQILGMQLVTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRATQK
VALIASSEGGMDIEEVAHSTPEKIITEMIDPLTGITAEQSRKVAAAIGLTGASVDQAVDL
FAKLYKCYMDTDASLVEINPLNCDSKGNLIALDAKFNFDANALFRHPDIVALRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATPEKVTE
AFKIMLKNPKVKGILVNIFGGIMKCDTIATGVITACKAVNLQVPLVVRMKGTNEELGKKM
LAESGLPIISADTMAEAATKIVEAVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgaataccaaggcaaggaaatcttgcgcagtttcggcgtgcccgtcccg
cgtggcattcccgctttcacggtgcaggaagccgtggaagccgcacaaaagctcggcggc
cccgtgtgggtcgtgaaggcgcagatccacgccggcggccgcggcaagggcggcggcgtg
aaggtcgccaagaccatcgacgacgtgaagaccctggccagccagatcctgggcatgcag
ctcgtcacgcaccagaccgggcccgagggccagaaggtgcgccgcctgtacatcgaggac
ggcgccgacatcaagaatgaactctacgtctcgctggtcaccgaccgtgccacgcagaag
gtggctctgatcgcctccagcgaaggcggcatggacatcgaggaagtggcccattccacg
cccgagaagatcatcaccgagatgatcgaccccctgaccggcatcaccgccgagcaatcg
cgcaaggtggcggccgccatcggcctgaccggtgcctcggtggaccaggccgtggacctg
ttcgcaaagctctacaagtgctacatggacacggacgcgtcgctggtcgagatcaacccg
ctgaactgcgactccaagggcaacctgatcgccctggacgccaagttcaacttcgacgcc
aacgcgctgttccgccaccccgacatcgtcgcgctgcgcgacctggacgaggaagacccc
gccgagatcgaggcctccaagttcgacctggcctacatcagcctggacggcaacatcggc
tgcctggtcaacggcgcgggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagcctgccaactttctggacgtgggcggcggcgccacccccgagaaggtcaccgag
gccttcaagatcatgctcaagaaccccaaggtcaagggcatcctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtgatcaccgcctgcaaggccgtgaac
ctgcaggtgccgctggtcgtgcgcatgaagggcacgaacgaagaactgggcaagaagatg
ctggccgaatccggcctgcccatcatcagcgccgacaccatggccgaagcggccacgaag
attgtcgaagccgtccgttaa

DBGET integrated database retrieval system