KEGG   Alicycliphilus denitrificans K601: Alide2_4652Help
Entry
Alide2_4652       CDS       T01463                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00010  Glycolysis / Gluconeogenesis
adk00620  Pyruvate metabolism
adk00640  Propanoate metabolism
adk00680  Methane metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_4652
   00620 Pyruvate metabolism
    Alide2_4652
   00640 Propanoate metabolism
    Alide2_4652
  Energy metabolism
   00680 Methane metabolism
    Alide2_4652
Enzymes [BR:adk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Alide2_4652
Lipid biosynthesis proteins [BR:adk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Alide2_4652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEB86954
UniProt: F4GBN3
Position
complement(4890527..4892077)
Genome map
AA seq 516 aa AA seqDB search
MPRLTDYQSYADAQAYFSAEKLWELFDGDRERLNIAHECVDRHADSGRDALIVAHADGAD
EVITYRELAEDSSRFAHYLERRGIQRGQRVAIMLDPSRAFYTAMFGVIKRGAIAVPLFTL
FGPDGIRLRVHDCQPALIVTNAQKMPVAVSATQVPALVYDDAFHASLQGLPPRYAVQTRA
DDLAVFQYTSGTTRELPDAVKHTHRALVTLTVAALYGTGLRPGDRFFCPSSPAWGHGLWH
GTLAPLGMGLTVGAYSGRFHPERLLQALSRHRFTNMSAAATHYRMMKNCGKAGDYAYCFG
KLSFTGEPIDDDTADFVRRTFGLEVCSMYGTTEIGVVLASYPGAPDFPVKRGSLGKPVPG
TRIEVHDAEGRPCPPGATGQLMVLRKGEWIPTKDLGRVDEDGYYYHAGRADDVIISAGWT
MSAVEIENAILLHPDVLEAAAIGVPDEVRGQVVKAFVVTGRAPGEPFVQEIQELVRSKLS
QHEYPRHVAFVPELPKTPAGKVHRKVLREREAAAAH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccccgactcaccgattaccagagctatgcggacgcccaggcgtatttctcggccgag
aaactctgggagcttttcgatggcgaccgcgagcgcctcaacatcgcccacgagtgcgtg
gaccggcacgcggacagcggccgcgacgcgctgatcgtggcccacgcggacggcgccgac
gaggtcatcacctaccgcgagctggccgaggattcgtcgcgcttcgcgcattacctggag
cggcgcggcatacagcgcgggcagcgcgtggcgatcatgctcgatccctcgcgcgccttc
tacacggcgatgttcggcgtcatcaagcgcggcgccatcgccgtgccgctgttcacgctg
ttcgggcccgacggcatccgcctgcgcgtccatgactgccagcccgcgctgatcgtcacc
aacgcgcagaagatgccggtcgccgtctcggcgacgcaggtgccggcgctcgtctacgac
gacgcgttccacgccagcctgcaggggctgcccccgcgctacgcggtgcagacgcgcgcc
gacgacctggcggtgttccagtacacctcgggcacgacgcgcgagctgcccgatgccgtg
aagcacacgcaccgggcgctggtcacgctcacggtggcggcgctgtacggcacgggcctg
cggccgggcgaccggttcttctgcccctcgtcgcccgcatgggggcacggcctgtggcac
ggcacgctggcgccgctgggcatggggctcacggtgggcgcgtacagcgggcgctttcat
cccgagcggctgctgcaggcgctgtcaaggcaccgtttcaccaacatgtcggccgccgcc
acgcactaccgcatgatgaagaactgcggcaaggcgggcgactacgcctactgcttcggc
aagctctcgttcaccggcgagcccatcgacgacgacacggccgacttcgtgcgccggacc
ttcggcctggaggtctgcagcatgtacggcaccaccgagatcggcgtggtgctggcgagc
taccccggcgcgccggacttccccgtcaagcgcggctcgctcggcaagcccgtgccgggc
acgcgcatcgaggtgcacgacgccgagggccgcccctgcccgcccggcgccacgggccag
ctcatggtgctgcgcaagggcgagtggataccgaccaaggacctgggccgcgtggacgag
gacggctactactaccacgcgggccgcgccgacgacgtgatcatctccgccggctggacc
atgagcgcggtggagatcgagaacgccatcctgctgcaccccgacgtgctcgaggctgcc
gccatcggcgtgcccgacgaggtgcgcggccaggtcgtcaaggccttcgtcgtcaccggc
cgcgcacccggcgagccgttcgtgcaggagatccaggagctggtgcgctccaagctcagc
cagcacgaatacccgcgccacgtggccttcgtgcccgagctgcccaagacccccgccggc
aaggtgcaccgcaaggtgctgcgcgagcgcgaggccgccgccgcgcattga

DBGET integrated database retrieval system